Property Summary

Ligand Count 225
NCBI Gene PubMed Count 243
PubMed Score 3496.65
PubTator Score 3413.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.800 1.5e-12

Synonym

Accession P00740 A8K9N4 F2RM36 Q5FBE1 Q5JYJ8
Symbols FIX
P19
PTC
HEMB
THPH8
F9 p22

Gene

F9

PANTHER Protein Class (3)

PDB (38)

Gene RIF (153)

AA Sequence

MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNLERECMEEKCS      1 - 70
FEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGR     71 - 140
CEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETI    141 - 210
LDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAG    211 - 280
EHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGS    281 - 350
GYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE    351 - 420
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT                                 421 - 461
//

Text Mined References (253)

PMID Year Title