Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.55
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
25102259 Periconception maternal smoking and low education are associated with dna methylation on INSIGF in the very young child.
25102180 We identified three known loci (TCF7L2, HMGA2 and KCNQ1) and two novel loci (HLA-B and INS-IGF2) at genome-wide significance (4.15 x 10(-94)
23935095 INS-IGF2 and insulin may share autoantibody-binding sites, thus complicating the notion that insulin is the primary autoantigen in type 1 diabetes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQASALSLSS      1 - 70
STSTWPEGLDATARAPPALVVTANIGQAGGSSSRQFRQRALGTSDSPVLFIHCPGAAGTAQGLEYRGRRV     71 - 140
TTELVWEEVDSSPQPQGSESLPAQPPAQPAPQPEPQQAREPSPEVSCCGLWPRRPQRSQN              141 - 200
//

Text Mined References (23)

PMID Year Title
25102259 2012 Periconception maternal smoking and low education are associated with methylation of INSIGF in children at the age of 17 months.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
23935095 2013 Autoimmunity against INS-IGF2 protein expressed in human pancreatic islets.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17700581 2008 Association between small for gestational age and paternally inherited 5' insulin haplotypes.
17667841 2007 Association between paternally inherited haplotypes upstream of the insulin gene and umbilical cord IGF-II levels.
17632545 2007 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.
More...