Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.55
PubTator Score 1.67

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
25102259 Periconception maternal smoking and low education are associated with dna methylation on INSIGF in the very young child.
25102180 We identified three known loci (TCF7L2, HMGA2 and KCNQ1) and two novel loci (HLA-B and INS-IGF2) at genome-wide significance (4.15 x 10(-94)
23935095 INS-IGF2 and insulin may share autoantibody-binding sites, thus complicating the notion that insulin is the primary autoantigen in type 1 diabetes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQASALSLSS      1 - 70
STSTWPEGLDATARAPPALVVTANIGQAGGSSSRQFRQRALGTSDSPVLFIHCPGAAGTAQGLEYRGRRV     71 - 140
TTELVWEEVDSSPQPQGSESLPAQPPAQPAPQPEPQQAREPSPEVSCCGLWPRRPQRSQN              141 - 200
//

Text Mined References (23)

PMID Year Title
25102259 2012 Periconception maternal smoking and low education are associated with methylation of INSIGF in children at the age of 17 months.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
23935095 2013 Autoimmunity against INS-IGF2 protein expressed in human pancreatic islets.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17700581 2008 Association between small for gestational age and paternally inherited 5' insulin haplotypes.
17667841 2007 Association between paternally inherited haplotypes upstream of the insulin gene and umbilical cord IGF-II levels.
17632545 2007 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16531418 2006 Imprinting of IGF2 P0 transcript and novel alternatively spliced INS-IGF2 isoforms show differences between mouse and human.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15008838 2004 Evidence for a Type 1 diabetes-specific mechanism for the insulin gene-associated IDDM2 locus rather than a general influence on autoimmunity.
11855150 2001 The effect of parental imprinting on the INS-IGF2 locus of Korean type I diabetic patients.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10431232 1999 Transmission ratio distortion at the INS-IGF2 VNTR.
8565331 1995 Imprinting of IGF2, insulin-dependent diabetes, immune function, and apoptosis: a hypothesis.
7913866 1994 Parental imprinting of human chromosome region 11p15.3-pter involved in the Beckwith-Wiedemann syndrome and various human neoplasia.
7672495 1995 Parental imprinting effect at the INS-IGF2 diabetes susceptibility locus.
2902788 1988 Linkage disequilibrium in the human insulin/insulin-like growth factor II region of human chromosome II.