Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession F8W1W9
Symbols

Gene

AA Sequence

MPMRVPEEVTLRNPGSSGRKERPEAGTGSWLGRTRNQVINSLAVYRHRETDFGVGVRDHPGQHGKTPSPQ      1 - 70
KLDNLIIIIIGFLRRYTFNILFCTSCLCVSFLKTIFWSRNGHDGSMDVQQRAWRSNRSRQKGLRSICMHT     71 - 140
KKRVSSFRGNKIGLKDVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRA    141 - 210
EDYHKCKIPPSARKPLCNWVRMAAAEHRHSSGLPYWLYLTAETLKNRMGRQPPPPTQQHSITDNSLSLKT    211 - 280
PPECLLTPLPPSVDDNIKECPLAPLPPSPLPPSVDDNLKECLFVPLPPSPLPPSVDDNLKECLFVPLPPS    281 - 350
PLPPSVDDNLKTPPLATQEAEVEKPPKPKRWRVDEVEQSPKPKRQREAEAQQLPKPKRRRLSKLRTRHCT    351 - 420
QAWAIRINP                                                                 421 - 429
//

Text Mined References (2)

PMID Year Title