Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cardiovascular system disease 194 1.0
Gout 93 1.0

Expression

Synonym

Accession F2Z3F1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MKRIFYKHRKRRAPVFKEPEHGYQSLPELVLVPAQPLVCLGDYRTPDPGGLFPWSLRLMMPGAWTKLPGD      1 - 70
GGSVPEKGKHGILGAQGQEHPGLNVSSPFSSPWTCYLSGHQPQNNNSPELQVKEILL                  71 - 127
//

Text Mined References (8)

PMID Year Title
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23966867 2013 Genome-wide association of body fat distribution in African ancestry populations suggests new loci.
23754948 2013 Sex-stratified genome-wide association studies including 270,000 individuals show sexual dimorphism in genetic loci for anthropometric traits.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
20864672 2010 Genetic variants influencing circulating lipid levels and risk of coronary artery disease.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.