Property Summary

NCBI Gene PubMed Count 1,276
PubMed Score 31685.18
PubTator Score 17181.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count Z-score Confidence
Liver disease 219 6.933 3.5
Vitamin K deficiency hemorrhagic disease 11 6.289 3.1
Antiphospholipid syndrome 18 6.178 3.1
Pulmonary Embolism 45 5.911 3.0
Thrombocytopenia 105 5.861 2.9
Blood protein disease 10 5.838 2.9
Protein C deficiency 19 5.795 2.9
Hepatic encephalopathy 25 5.793 2.9
Cancer 2346 5.792 2.9
Cerebrovascular disease 231 5.576 2.8
Atrial Fibrillation 110 5.456 2.7
Portal vein thrombosis 9 5.179 2.6
Esophageal varix 10 5.121 2.6
Coronary artery disease 240 5.109 2.6
Hepatitis B 103 5.069 2.5
Factor VII deficiency 5 5.001 2.5
Factor X deficiency 5 4.978 2.5
Hyperhomocysteinemia 34 4.958 2.5
Hepatic vein thrombosis 8 4.895 2.4
Varicose veins 15 4.895 2.4
Antithrombin III deficiency 9 4.853 2.4
Portal hypertension 21 4.85 2.4
Lupus erythematosus 80 4.798 2.4
Hemophilia B 11 4.691 2.3
Kidney disease 397 4.654 2.3
Placental abruption 16 4.633 2.3
Hypertension 293 4.599 2.3
Factor V deficiency 7 4.517 2.3
Anemia 252 4.484 2.2
Factor XI deficiency 9 4.431 2.2
Von Willebrand's disease 19 4.397 2.2
Cholestasis 93 4.315 2.2
Hypochondriasis 7 4.217 2.1
Connective tissue disease 59 4.204 2.1
Hepatitis A 10 4.171 2.1
Thrombophlebitis 16 4.135 2.1
Peripheral vascular disease 90 4.108 2.1
Bilirubin metabolic disorder 39 4.099 2.0
Hepatitis C 90 4.003 2.0
Lung disease 136 3.977 2.0
Peritonitis 37 3.799 1.9
Purpura 17 3.795 1.9
diabetes mellitus 1663 3.787 1.9
Factor XIII deficiency 7 3.674 1.8
Leukopenia 42 3.669 1.8
Hypersplenism 9 3.632 1.8
Factor VIII deficiency 10 3.615 1.8
Diarrhea 155 3.598 1.8
Endocarditis 18 3.541 1.8
Autoimmune hepatitis 13 3.517 1.8
post-thrombotic syndrome 5 3.498 1.7
Vasculitis 64 3.436 1.7
Atherosclerosis 275 3.429 1.7
Cholangitis 20 3.418 1.7
Crimean-Congo hemorrhagic fever 10 3.38 1.7
Congenital heart disease 63 3.331 1.7
Asthma 349 3.204 1.6
Factor XII deficiency 11 3.182 1.6
Lactic acidosis 43 3.181 1.6
Transient cerebral ischemia 14 3.177 1.6
Exanthem 39 3.152 1.6
Congenital afibrinogenemia 9 3.061 1.5
Aortic aneurysm 34 3.027 1.5
Mitral valve stenosis 10 3.012 1.5

Expression

Synonym

Accession P00734 B2R7F7 B4E1A7 Q4QZ40 Q53H04 Q53H06 Q69EZ7 Q7Z7P3 Q9UCA1
Symbols PT
THPH1
RPRGL2

Gene

F2

PANTHER Protein Class (3)

PDB

3QDZ   1SR5   1TB6   2B5T   1NY2   1NRN   1NRO   1NRP   1NRQ   1NRR   3BEF   3HKJ   3LU9   3P6Z   3P70   2A45   2HWL   1DM4   1FPH   1A2C   1A3B   1A3E   1A46   1A4W   1A5G   1A61   1ABI   1ABJ   1AD8   1AE8   1AFE   1AHT   1AI8   1AIX   1AWF   1AWH   1AY6   1B5G   1B7X   1BA8   1BB0   1BCU   1BHX   1BMM   1BMN   1BTH   1C1U   1C1V   1C1W   1C4U   1C4V   1C4Y   1C5L   1C5N   1C5O   1CA8   1D3D   1D3P   1D3Q   1D3T   1D4P   1D6W   1D9I   1DE7   1DIT   1DOJ   1DWB   1DWC   1DWD   1DWE   1DX5   1E0F   1EB1   1EOJ   1EOL   1FPC   1G30   1G32   1G37   1GHV   1GHW   1GHX   1GHY   1GJ4   1GJ5   1H8D   1H8I   1HAG   1HAH   1HAI   1HAO   1HAP   1HBT   1HDT   1HGT   1HLT   1HUT   1HXE   1HXF   1IHS   1IHT   1JMO   1JOU   1JWT   1K21   1K22   1KTS   1KTT   1LHC   1LHD   1LHE   1LHF   1LHG   1MH0   1MU6   1MU8   1MUE   1NM6   1NO9   1NRS   1NT1   1NU7   1NU9   1NZQ   1O0D   1O2G   1O5G   1OOK   1OYT   1P8V   1PPB   1QBV   1QHR   1QJ1   1QJ6   1QJ7   1QUR   1RD3   1RIW   1SB1   1SFQ   1SG8   1SGI   1SHH   1SL3   1T4U   1T4V   1TA2   1TA6   1TBZ   1THP   1THR   1THS   1TMB   1TMT   1TMU   1TOM   1TQ0   1TQ7   1TWX   1UMA   1UVS   1VR1   1VZQ   1W7G   1WAY   1WBG   1XM1   1XMN   1YPE   1YPG   1YPJ   1YPK   1YPL   1YPM   1Z71   1Z8I   1Z8J   1ZGI   1ZGV   1ZRB   2A0Q   2A2X   2AFQ   2ANK   2ANM   2BDY   2BVR   2BVS   2BVX   2BXT   2BXU   2C8W   2C8X   2C8Y   2C8Z   2C90   2C93   2CF8   2CF9   2CN0   2FEQ   2FES   2GDE   2GP9   2H9T   2HGT   2HNT   2HPP   2HPQ   2JH0   2JH5   2JH6   2OD3   2PGB   2PGQ   2PKS   2PW8   2R2M   2THF   2UUF   2UUJ   2UUK   2V3H   2V3O   2ZC9   2ZDA   2ZDV   2ZF0   2ZFF   2ZFP   2ZFQ   2ZFR   2ZG0   2ZGB   2ZGX   2ZHE   2ZHF   2ZHQ   2ZHW   2ZI2   2ZIQ   2ZNK   2ZO3   3B23   3B9F   3BEI   3BF6   3BIU   3BIV   3BV9   3C1K   3C27   3D49   3DA9   3DD2   3DHK   3DT0   3DUX   3E6P   3EE0   3EGK   3EQ0   3F68   3GIC   3GIS   3HAT   3HTC   3JZ1   3JZ2   3K65   3LDX   3NXP   3P17   3PMH   3PO1   3QGN   3QLP   3QTO   3QTV   3QWC   3QX5   3R3G   3RLW   3RLY   3RM0   3RM2   3RML   3RMM   3RMN   3RMO   3S7H   3S7K   3SHA   3SHC   3SI3   3SI4   3SQE   3SQH   3SV2   3T5F   3TU7   3U69   3U8O   3U8R   3U8T   3U98   3U9A   3UTU   3UWJ   3VXE   3VXF   4AX9   4AYV   4AYY   4AZ2   4BAH   4BAK   4BAM   4BAN   4BAO   4BAQ   4BOH   4CH2   4CH8   4DIH   4DII   4DT7   4DY7   4E05   4E06   4E7R   4H6S   4H6T   4HFP   4HTC   4HZH   4I7Y   4LOY   4LXB   4LZ1   4LZ4   4MLF   4N3L   4NZE   4NZQ   4O03   4RKJ   4RKO   4RN6   4THN   4UD9   4UDW   4UE7   4UEH   4UFD   4UFE   4UFF   4UFG   4YES   5A2M   5AF9   5AFY   5AFZ   5AHG   5CMX   5E8E   5EDK   5EDM   5GDS   5JDU   5LUY   7KME   8KME  

  Ortholog (13)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1046 screening 557 / 0 / 216693 Thrombin 1536 HTS
1215 confirmatory 223 / 12 / 294 Thrombin 1536 HTS Dose Response Confirmation

Gene RIF (1228)

PMID Text
27070780 the accuracy of des-gamma-carboxy prothrombin for distinguishing hepatocellular carcinoma from various controls was 6.2-9.7% higher than that of alpha-fetoprotein
27031503 Studies indicate that prothrombin G20210A mutation is significantly associated with cerebral venous thrombosis when compared to healthy controls, although this association is highly dependent on the country of origin.
26986465 AFP remained the best single marker, and the combined use of AFP with prothrombin precursor or DKK-1 had the best diagnostic performance compared to all other possible combinations of the four biomarkers, even in early stage hepatocellular carcinoma.
26957205 Data suggest that thrombin can directly activate PAR2 vasorelaxation, signal transduction (stimulating both calcium and MAP kinase responses), and triggering beta-arrestin recruitment (both beta-arrestin 1 and 2).
26840958 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26771969 Report prolonged post-PCI inflammatory reaction, reflected by elevated CRP, and increased thrombin generation.
26768578 Factor V Leiden, prothrombin G20210A, and thrombospondin-1 polymorphisms showed no association with severity of hepatic fibrosis. the risk of Hepatocellular Carcinoma was increased 5-fold in subjects carrying GA genotype of prothrombin G20210A gene.
26763231 A flexible linker presents the sites of cleavage of prothrombin to factor Xa in different orientations by pivoting the C-terminal kringle-2/protease domain pair on the N-terminal Gla domain/kringle-1 pair anchored to the membrane.
26761005 This review focuses on elucidation of the cerebral thrombin expression, local generation and its role in injury and disease of the central nervous system. [review]
26608329 Thrombin and fibrinogen gamma' regulate protofibril packing within fibrin fibers and thereby influence clot stiffness.
More...

AA Sequence

MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLERECVEETCSYEEA      1 - 70
FEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHVNITRSGIECQLWRSRYPHKP     71 - 140
EINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPL    141 - 210
EQCVPDRGQQYQGRLAVTTHGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKP    211 - 280
GDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDK    281 - 350
TERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN    351 - 420
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAA    421 - 490
SLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKR    491 - 560
GDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE            561 - 622
//

Text Mined References (1294)

PMID Year Title
27070780 2016 Diagnostic Evaluation of Des-Gamma-Carboxy Prothrombin versus ?-Fetoprotein for Hepatitis B Virus-Related Hepatocellular Carcinoma in China: A Large-Scale, Multicentre Study.
27031503 2016 Prevalence and Geographical Variation of Prothrombin G20210A Mutation in Patients with Cerebral Vein Thrombosis: A Systematic Review and Meta-Analysis.
26986465 2016 Diagnostic Performance of Alpha-Fetoprotein, Protein Induced by Vitamin K Absence, Osteopontin, Dickkopf-1 and Its Combinations for Hepatocellular Carcinoma.
26957205 2016 Thrombin-Mediated Direct Activation of Proteinase-Activated Receptor-2: Another Target for Thrombin Signaling.
26840958 2016 Inhibition of Cellular Adhesion by Immunological Targeting of Osteopontin Neoepitopes Generated through Matrix Metalloproteinase and Thrombin Cleavage.
26771969 Prolonged CRP Increase After Percutaneous Coronary Intervention Is Associated with High Thrombin Concentrations and Low Platelet' Response to Clopidogrel in Patients with Stable Angina.
26768578 2016 Association of thrombogenic genes polymorphisms with hepatocellular carcinoma in HCV Egyptian patients.
26763231 2016 How the Linker Connecting the Two Kringles Influences Activation and Conformational Plasticity of Prothrombin.
26761005 2016 The Importance of Thrombin in Cerebral Injury and Disease.
26608329 2016 Thrombin and fibrinogen ?' impact clot structure by marked effects on intrafibrillar structure and protofibril packing.
More...