Property Summary

NCBI Gene PubMed Count 83
PubMed Score 241.16
PubTator Score 154.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.100 2.2e-04
glioblastoma 1.100 6.1e-03
lung adenocarcinoma 1.300 3.8e-11
non-small cell lung cancer 1.287 7.5e-16
osteosarcoma 1.347 3.1e-03
pediatric high grade glioma 1.500 1.1e-02
psoriasis 1.100 1.2e-35

Protein-protein Interaction (1)

Gene RIF (66)

AA Sequence

MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHFQETWLAEAQV      1 - 70
PDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHHGEQCLYSSAYDPPRQIAIKS     71 - 140
PAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGEHSSVFQQPLDICHSFTSQGGGREPLPAPYQ    141 - 210
HQLSEPCPPYPQQSFKQEYHDPLYEQAGQPAVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYL    211 - 280
HTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVAL    281 - 350
LDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF    351 - 420
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY          421 - 484
//

Text Mined References (89)

PMID Year Title