Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.58
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 9.2e-27

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.100 9.2e-27

AA Sequence

MHCSCLAEGIPANPGNWISGLAFPDWAYKAESSPGSRQIQLWHFILELLQKEEFRHVIAWQQGEYGEFVI      1 - 70
KDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFSKLIVVNYPLWEVRAPPSP     71 - 140
HLLLGAPALCRPALVPVGVQSELLHSMLFAHQAMVEQLTGQQTPRGPPETSGDKKGSSSSVYRLGSAPGP    141 - 210
CRLGLCCHLGSVQGELPGVASFTPPLPPPLPSNWTCLSGPFLPPLPSEQQLPGAFKPDILLPGPRSLPGA    211 - 280
WHFPGLPLLAGLGQGAGERLWLLSLRPEGLEVKPAPMMEAKGGLDPREVFCPETRRLKTGEESLTSPNLE    281 - 350
NLKAVWPLDPP                                                               351 - 361
//

Text Mined References (2)

PMID Year Title
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.