Property Summary

NCBI Gene PubMed Count 73
PubMed Score 120.04
PubTator Score 86.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -3.500 3.7e-08
astrocytic glioma 2.400 1.4e-02
oligodendroglioma 3.000 4.5e-03
psoriasis -1.500 9.1e-03
glioblastoma 1.800 1.8e-02
osteosarcoma 1.326 8.0e-03
posterior fossa group B ependymoma -2.400 6.8e-05
cystic fibrosis 3.232 1.2e-06
medulloblastoma, large-cell -3.400 6.1e-04
non-small cell lung cancer -1.623 8.4e-14
lung cancer -3.000 4.2e-05
pancreatic cancer 1.300 4.7e-04
lung adenocarcinoma -1.500 5.3e-14
pediatric high grade glioma 1.800 2.4e-03
pilocytic astrocytoma 1.300 1.5e-02
sonic hedgehog group medulloblastoma -1.600 2.5e-02
subependymal giant cell astrocytoma -3.252 2.7e-02
severe Alzheimer's disease -1.504 1.7e-02
breast carcinoma -1.200 4.5e-13
Breast cancer -2.600 1.5e-16
ovarian cancer 3.200 2.3e-04
pituitary cancer -2.700 7.5e-07

Gene RIF (47)

PMID Text
26731476 these data reveal a JMJD2A/ETV1/YAP1 axis that promotes prostate cancer initiation and that may be a suitable target for therapeutic inhibition.
26243012 conclude that ETV1 is specifically expressed in the majority of gastrointestinal stromal tumors, even in some KIT-negative cases
25884720 ETV1 and COP1 are a pair of independent predictors of prognosis for triple-negative breast cancer.
25736805 mutation of the KIT protein that stabilizes ETV1 is likely to be a key step by which an endogenous brain-cell progenitor may form a germinoma.
25631336 These results illuminate the complex interplay of AR, ETV1, and PTEN pathways in pre-cancerous neoplasia and early tumorigenesis
25595908 ETV1 overexpression is associated with prostate cancer aggressiveness.
25479232 YK-4-279 is a potent inhibitor of ETV1 and inhibits both the primary tumor growth and metastasis of fusion positive prostate cancer xenografts.
25203299 developed a novel RNA in situ hybridization-based assay for the in situ detection of ETV1, ETV4, and ETV5 in formalin-fixed paraffin-embedded tissues from prostate needle biopsies, prostatectomy, and metastatic PCa specimens using RNA probes
25073704 ETV1 expression is a rare event in human melanoma and seems to be rather based on hyperactivation of MAPK signals, by BRAF (V600E) mutation, than on ETV1 gene amplification.
24970355 Results show that ETV1 was upregulated at a higher rate in Gastrointestinal stromal tumor and was correlated with KIT expression.
24737027 These results point to a new avenue for pharmacologic ETV1 inhibition and may inform a general means to discover small molecule perturbagens of transcription factor oncoproteins.
24157551 Elevated levels of either wild-type ETV1 or its truncated derivative, dETV1, which mimics the product of an oncogenic rearrangement in certain tumors, results in increased expression of mRNA for p14ARF, a known activator of p53.
24100634 ETV1 expression is significantly correlated with Snail expression in human gastric tumor samples. In summary, we present data that ETV1 promotes Snail expression to induce EMT-like metastatic progression in gastric cancer.
23977394 The gastrointestinal stromal tumor-specific transcription factor ETV1 may have no prognostic potential, whereas its downstream gene KCTD10 is associated with a favorable prognosis.
23817021 Expression of ERG and ETV1 correlated with higher AR transcriptional output in PTEN-deficient prostate cancer specimens.
23774214 Non-sigma 14-3-3 proteins synergized with ETV1 to activate transcription.
23522042 Proprioceptive sensory neurons innervating hypaxial and axial muscles depend critically on Etv1 for survival.
23512661 confirmed the association of an ETV1 expression signature with aggressive disease and poorer outcome in patient data
23284306 Our collective results identify a regulatory pathway involving ETV1, ATR, and TERT that is preferentially important for proliferation of diverse p53- cancer cells
23076342 High ETV1 expression is associated with prostate cancer.
22901226 High ER81 expression is associated with breast cancer.
22425584 Reviews evidence for a role of ETV1, 4 and 5 as oncoproteins and describe modes of their action.
22351694 Data show that MAPKAP kinase 2 overexpression is associated with expression of p38 MAP kinase and ETV1 in gastrointestinal stromal tumors (GIST).
21689625 Pea3 and Erm, but not Er81, play an important role in the progression of esophageal squamous cell carcinoma
21673681 High ER81 expression is associated with gastric adenocarcinoma.
21622576 The coordinate expression of Etv1 with POMC cell differentiation and its interaction with the highly cell-restricted Tpit factor indicate that Etv1 participates in a combinatorial code for pituitary cell-specific gene expression.
21559405 ERG and ETV1 mediated prostate cancer cell invasion is inhibited by YK-4-279
21298110 in clinical prostate cancer overexpression of full-length ETV1 is due to genomic rearrangements involving different chromosomes
20927104 the ETS family member ETV1 is highly expressed in the subtypes of interstitial cells of Cajal sensitive to oncogenic KIT mediated transformation, and is required for their development
20160028 Melanoma cell lines, including those with ETV1 amplification, exhibited dependency on ETV1 expression for proliferation and anchorage-independent growth.
20104229 ERG/ETV1 gene rearrangements and PTEN gene loss status should now prospectively be incorporated into a predictive model to establish whether predictive performance is improved.
19789348 Overexpression of ETV1 is associated with tha induction of prostatic intraepithelial neoplasia.
19718948 Transcriptional activation of hTERT in breast carcinomas by the Her2-ER81-related pathway.
19465903 1% histologic variant of prostate carcinoma or variation morphologies demonstrated ETV! aberrations
19223501 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
18726892 ETV1 and HER2/Neu synergized to upregulate the endogenous Rcl gene. ETV1 also bound to the Rcl promoter.
18628953 Sox-9, ER81 and VE-cadherin have roles in retinoic acid-mediated trans-differentiation of breast cancer cells
18594527 Studies report a novel fusion partner for ETV1 and highlight the considerable heterogeneity of ETV1 gene rearrangements in human prostate cancer.
18474293 Detection of ETS fusion gene by RT-PCR is feasible on formalin-fixed and paraffin-embedded samples.
17634427 These results imply that c-Jun plays a pivotal role in the pathway that connects ligand-activated AR to elevated ETV1 expression, leading to enhanced expression of matrix metalloproteinases and prostate cancer cell invasion.
17632455 TMPRSS2-ERV1 fusion protein was found in 1/82 prostate neoplasms.
17505060 Expression transitions from androgen-induced to androgen-independent as prostate cancer cells switch from hormone-dependent to hormone-refractory.
17390040 findings show that the TMPRSS2-ERG fusion is common in prostate cancer and that the related TMPRSS2-ETV1 fusion is very rare
17032499 demonstrate for the first time that the TMPRSS2-ERG fusion gene can be detected in a proportion of HGPIN lesions and that this molecular rearrangement is an early event that may precede chromosome-level alterations in prostate carcinogenesis
14747462 transcription factor ER81 is regulated by oncogenic HER2/Neu and ACTR in mammary tumorigenesis
12947087 attenuation of transforming growth factor-beta signaling by activating Smad7 transcription may proceed not only through TGF-beta receptor-regulated Smad proteins but also an independent pathway involving transcription factor ER81 and TAK1 protein kinase
12917345 ER81 is acetylated by two coactivators/acetyltransferases, p300 and p300- and CBP-associated factor (P/CAF) . Whereas p300 acetylates two lysine residues (K33 and K116) within the ER81 N-terminal transactivation domain, P/CAF targets only K116.

AA Sequence

MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQF      1 - 70
VPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTP     71 - 140
SSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPM    141 - 210
YQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQE    211 - 280
GFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSN    281 - 350
SHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA    351 - 420
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY                 421 - 477
//

Text Mined References (74)

PMID Year Title
26731476 2016 Histone demethylase JMJD2A drives prostate tumorigenesis through transcription factor ETV1.
26243012 2015 ETV1 mRNA is specifically expressed in gastrointestinal stromal tumors.
25884720 2015 COP1, the negative regulator of ETV1, influences prognosis in triple-negative breast cancer.
25736805 2015 Expression of Kit and Etv1 in restricted brain regions supports a brain-cell progenitor as an origin for cranial germinomas.
25631336 2015 Interaction of the Androgen Receptor, ETV1, and PTEN Pathways in Mouse Prostate Varies with Pathological Stage and Predicts Cancer Progression.
25595908 2015 Specific and redundant activities of ETV1 and ETV4 in prostate cancer aggressiveness revealed by co-overexpression cellular contexts.
25479232 2014 A small molecule inhibitor of ETV1, YK-4-279, prevents prostate cancer growth and metastasis in a mouse xenograft model.
25203299 2014 Novel RNA hybridization method for the in situ detection of ETV1, ETV4, and ETV5 gene fusions in prostate cancer.
25073704 2014 MAP kinase activity supported by BRAF (V600E) mutation rather than gene amplification is associated with ETV1 expression in melanoma brain metastases.
24970355 2014 Altered expression of ETV1 and its contribution to tumorigenic phenotypes in gastrointestinal stromal tumors.
24737027 2014 A small molecule that binds and inhibits the ETV1 transcription factor oncoprotein.
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
24157551 2013 ETV1 positively regulates transcription of tumor suppressor ARF.
24100634 2013 ETV1 induces epithelial to mesenchymal transition in human gastric cancer cells through the upregulation of Snail expression.
23977394 2013 Gene expression network analysis of ETV1 reveals KCTD10 as a novel prognostic biomarker in gastrointestinal stromal tumor.
23817021 2013 ETS factors reprogram the androgen receptor cistrome and prime prostate tumorigenesis in response to PTEN loss.
23774214 2013 14-3-3 proteins modulate the ETS transcription factor ETV1 in prostate cancer.
23522042 2013 Etv1 inactivation reveals proprioceptor subclasses that reflect the level of NT3 expression in muscle targets.
23512661 2013 ETV1 directs androgen metabolism and confers aggressive prostate cancer in targeted mice and patients.
23284306 2012 A synthetic interaction screen identifies factors selectively required for proliferation and TERT transcription in p53-deficient human cancer cells.
23076342 2013 ETS variant 1 regulates matrix metalloproteinase-7 transcription in LNCaP prostate cancer cells.
22901226 2012 ER81-shRNA inhibits growth of triple-negative human breast cancer cell line MDA-MB-231 in vivo and in vitro.
22425584 2012 ETV1, 4 and 5: an oncogenic subfamily of ETS transcription factors.
22351694 2012 MAPKAP kinase 2 overexpression influences prognosis in gastrointestinal stromal tumors and associates with copy number variations on chromosome 1 and expression of p38 MAP kinase and ETV1.
21689625 2011 The role of Pea3 group transcription factors in esophageal squamous cell carcinoma.
21673681 2011 PEA3/ETV4-related transcription factors coupled with active ERK signalling are associated with poor prognosis in gastric adenocarcinoma.
21622576 2011 The Ets factor Etv1 interacts with Tpit protein for pituitary pro-opiomelanocortin (POMC) gene transcription.
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21559405 2011 YK-4-279 inhibits ERG and ETV1 mediated prostate cancer cell invasion.
21298110 2011 Overexpression of full-length ETV1 transcripts in clinical prostate cancer due to gene translocation.
21036922 2011 Discovery of non-ETS gene fusions in human prostate cancer using next-generation RNA sequencing.
20927104 2010 ETV1 is a lineage survival factor that cooperates with KIT in gastrointestinal stromal tumours.
20160028 2010 An oncogenic role for ETV1 in melanoma.
20104229 2010 Molecular characterisation of ERG, ETV1 and PTEN gene loci identifies patients at low and high risk of death from prostate cancer.
20096094 2010 Brn3a regulates neuronal subtype specification in the trigeminal ganglion by promoting Runx expression during sensory differentiation.
19789348 2009 Induction of prostatic intraepithelial neoplasia and modulation of androgen receptor by ETS variant 1/ETS-related protein 81.
19718948 2009 Transcriptional activation of hTERT in breast carcinomas by the Her2-ER81-related pathway.
19465903 2009 Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma.
19223501 2009 Utility of incorporating genetic variants for the early detection of prostate cancer.
18726892 2008 Rcl is a novel ETV1/ER81 target gene upregulated in breast tumors.
18628953 2008 Role of Sox-9, ER81 and VE-cadherin in retinoic acid-mediated trans-differentiation of breast cancer cells.
18594527 2008 Heterogeneity and clinical significance of ETV1 translocations in human prostate cancer.
18474293 2008 Detection of the TMPRSS2-ETS fusion gene in prostate carcinomas: retrospective analysis of 55 formalin-fixed and paraffin-embedded samples with clinical data.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17671502 2007 Distinct classes of chromosomal rearrangements create oncogenic ETS gene fusions in prostate cancer.
17634427 2007 c-Jun has multiple enhancing activities in the novel cross talk between the androgen receptor and Ets variant gene 1 in prostate cancer.
17632455 2007 Gene fusions between TMPRSS2 and ETS family genes in prostate cancer: frequency and transcript variant analysis by RT-PCR and FISH on paraffin-embedded tissues.
17505060 2007 ETV1 is a novel androgen receptor-regulated gene that mediates prostate cancer cell invasion.
17390040 2007 Molecular genetic analyses of the TMPRSS2-ERG and TMPRSS2-ETV1 gene fusions in 50 cases of prostate cancer.
17032499 2006 TMPRSS2-ERG gene fusion causing ERG overexpression precedes chromosome copy number changes in prostate carcinomas and paired HGPIN lesions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16254181 2005 Recurrent fusion of TMPRSS2 and ETS transcription factor genes in prostate cancer.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14747462 2004 Concerted activation of ETS protein ER81 by p160 coactivators, the acetyltransferase p300 and the receptor tyrosine kinase HER2/Neu.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12947087 2003 HER2/Neu- and TAK1-mediated up-regulation of the transforming growth factor beta inhibitor Smad7 via the ETS protein ER81.
12917345 2003 Acetylation-mediated transcriptional activation of the ETS protein ER81 by p300, P/CAF, and HER2/Neu.
12853948 2003 The DNA sequence of human chromosome 7.
12750007 2003 Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12569367 2003 Regulation of the ER81 transcription factor and its coactivators by mitogen- and stress-activated protein kinase 1 (MSK1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213813 2002 Regulation of the ETS transcription factor ER81 by the 90-kDa ribosomal S6 kinase 1 and protein kinase A.
11551945 2001 Cell type-specific inhibition of the ETS transcription factor ER81 by mitogen-activated protein kinase-activated protein kinase 2.
10597226 1999 Characterization of the human and mouse ETV1/ER81 transcription factor genes: role of the two alternatively spliced isoforms in the human.
9681824 1998 Erg proteins, transcription factors of the Ets family, form homo, heterodimers and ternary complexes via two distinct domains.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
7700648 1995 A variant Ewing's sarcoma translocation (7;22) fuses the EWS gene to the ETS gene ETV1.
7651741 1995 Molecular characterization of the ets-related human transcription factor ER81.
1340465 1992 Specificities of protein-protein and protein-DNA interaction of GABP alpha and two newly defined ets-related proteins.