Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.93
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.6e-09
osteosarcoma 7950 4.4e-07

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.088 4.4e-07
ovarian cancer -1.500 3.6e-09

Gene RIF (3)

AA Sequence

MALSLGWKAHRNHCGLLLQALRSSGLLLFPCGQCPWRGAGSFLDPEIKAFLEENTEVTSSGSLTPEIQLR      1 - 70
LLTPRCKFWWERADLWPHSDPYWAIYWPGGQALSRYLLDNPDVVRGKSVLDLGSGCGATAIAAKMSGASR     71 - 140
ILANDIDPIAGMAITLNCELNRLNPFPILIQNILNLEQDKWDLVVLGDMFYDEDLADSLHQWLKKCFWTY    141 - 210
RTRVLIGDPGRPQFSGHSIQHHLHKVVEYSLLESTRQENSGLTTSTVWGFQP                      211 - 262
//

Text Mined References (9)

PMID Year Title