Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.98
PubTator Score 3.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.4e-03
ependymoma -1.100 1.5e-03
glioblastoma -1.100 5.9e-03
group 3 medulloblastoma -1.900 4.7e-05
lung adenocarcinoma -1.500 2.4e-09
non-small cell lung cancer -1.426 9.6e-23
osteosarcoma 1.606 1.5e-03
pediatric high grade glioma -1.100 2.4e-04
primitive neuroectodermal tumor -1.400 1.0e-03
psoriasis 1.600 3.8e-26

Gene RIF (3)

AA Sequence

MRAEEPCAPGAPSALGAQRTPGPELRLSSQLLPELCTFVVRVLFYLGPVYLAGYLGLSITWLLLGALLWM      1 - 70
WWRRNRRGKLGRLAAAFEFLDNEREFISRELRGQHLPAWIHFPDVERVEWANKIISQTWPYLSMIMESKF     71 - 140
REKLEPKIREKSIHLRTFTFTKLYFGQKCPRVNGVKAHTNTCNRRRVTVDLQICYIGDCEISVELQKIQA    141 - 210
GVNGIQLQGTLRVILEPLLVDKPFVGAVTVFFLQKPHLQINWTGLTNLLDAPGINDVSDSLLEDLIATHL    211 - 280
VLPNRVTVPVKKGLDLTNLRFPLPCGVIRVHLLEAEQLAQKDNFLGLRGKSDPYAKVSIGLQHFRSRTIY    281 - 350
RNLNPTWNEVFEFMVYEVPGQDLEVDLYDEDTDRDDFLGSLQICLGDVMTNRVVDEWFVLNDTTSGRLHL    351 - 420
RLEWLSLLTDQEVLTEDHGGLSTAILVVFLESACNLPRNPFDYLNGEYRAKKLSRFARNKVSKDPSSYVK    421 - 490
LSVGKKTHTSKTCPHNKDPVWSQVFSFFVHNVATERLHLKVLDDDQECALGMLEVPLCQILPYADLTLEQ    491 - 560
RFQLDHSGLDSLISMRLVLRFLQVEERELGSPYTGPEALKKGPLLIKKVATNQGPKAQPQEEGPTDLPCP    561 - 630
PDPASDTKDVSRSTTTTTSATTVATEPTSQETGPEPKGKDSAKRFCEPIGEKKSPATIFLTVPGPHSPGP    631 - 700
IKSPRPMKCPASPFAWPPKRLAPSMSSLNSLASSCFDLADISLNIEGGDLRRRQLGEIQLTVRYVCLRRC    701 - 770
LSVLINGCRNLTPCTSSGADPYVRVYLLPERKWACRKKTSVKRKTLEPLFDETFEFFVPMEEVKKRSLDV    771 - 840
AVKNSRPLGSHRRKELGKVLIDLSKEDLIKGFSQWYELTPNGQPRS                            841 - 886
//

Text Mined References (14)

PMID Year Title