Property Summary

Ligand Count 9
NCBI Gene PubMed Count 82
PubMed Score 159.10
PubTator Score 87.81

Knowledge Summary

Patent (6,698)


  Differential Expression (20)

Disease log2 FC p
lung cancer 2.300 6.7e-05
adult high grade glioma -1.600 6.4e-03
astrocytic glioma -1.800 8.7e-03
Astrocytoma, Pilocytic -1.300 1.2e-03
atypical teratoid / rhabdoid tumor -3.900 7.7e-09
cutaneous lupus erythematosus -1.100 1.1e-02
dermatomyositis 1.300 1.1e-02
ductal carcinoma in situ 1.400 3.9e-02
ependymoma -1.700 2.0e-02
fascioscapulohumeral muscular dystrophy 1.060 5.8e-03
gastric carcinoma -4.800 4.4e-02
glioblastoma -1.200 8.8e-04
group 3 medulloblastoma 1.400 3.8e-02
interstitial cystitis -2.000 2.5e-04
intraductal papillary-mucinous adenoma (... -1.200 3.1e-02
intraductal papillary-mucinous neoplasm ... -2.200 9.5e-03
medulloblastoma, large-cell 1.200 2.2e-02
nephrosclerosis -1.562 5.6e-03
pancreatic cancer -1.400 1.6e-04
psoriasis -1.100 1.7e-07

PDB (16)

Gene RIF (57)

AA Sequence

LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV                                    421 - 458

Text Mined References (88)

PMID Year Title