Property Summary

Ligand Count 956
NCBI Gene PubMed Count 2,688
PubMed Score 8421.58
PubTator Score 11099.47

Knowledge Summary

Patent (299,825)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.800 1.1e-07
lung cancer -2.000 1.9e-02
adrenocortical carcinoma -1.332 1.8e-03
Atopic dermatitis -1.300 8.8e-04
breast carcinoma 2.000 2.2e-04
cystic fibrosis 1.100 4.9e-04
interstitial cystitis -1.200 4.8e-02
intraductal papillary-mucinous adenoma (... -1.600 4.4e-03
intraductal papillary-mucinous carcinoma... -1.800 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.9e-02
malignant mesothelioma -1.300 1.1e-04
osteosarcoma -2.199 1.9e-03
pituitary cancer -3.200 5.1e-06
psoriasis -1.100 3.5e-05

Synonym

Accession P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 ER
Symbols ER
ESR
Era
ESRA
ESTRR
NR3A1

Gene

PDB

1A52   1AKF   1ERE   1ERR   1G50   1GWQ   1GWR   1HCP   1HCQ   1L2I   1PCG   1QKT   1QKU   1R5K   1SJ0   1UOM   1X7E   1X7R   1XP1   1XP6   1XP9   1XPC   1XQC   1YIM   1YIN   1ZKY   2AYR   2B1V   2B1Z   2B23   2BJ4   2FAI   2G44   2G5O   2I0J   2IOG   2IOK   2JF9   2JFA   2LLO   2LLQ   2OCF   2OUZ   2P15   2POG   2Q6J   2Q70   2QA6   2QA8   2QAB   2QE4   2QGT   2QGW   2QH6   2QR9   2QSE   2QXM   2QXS   2QZO   2R6W   2R6Y   2YAT   2YJA   3CBM   3CBO   3CBP   3DT3   3ERD   3ERT   3HLV   3HM1   3L03   3OS8   3OS9   3OSA   3Q95   3UU7   3UUA   3UUC   3UUD   4AA6   4DMA   4IU7   4IUI   4IV2   4IV4   4IVW   4IVY   4IW6   4IW8   4IWC   4IWF   4JC3   4JDD   4MG5   4MG6   4MG7   4MG8   4MG9   4MGA   4MGB   4MGC   4MGD   4O6F   4PP6   4PPP   4PPS   4PXM   4Q13   4Q50   4TUZ   4TV1   4XI3   4ZN7   4ZN9   4ZNH   4ZNS   4ZNT   4ZNU   4ZNV   4ZNW   5AAU   5AAV   5ACC   5AK2   5DI7   5DID   5DIE   5DIG   5DK9   5DKB   5DKE   5DKG   5DKS   5DL4   5DLR   5DMC   5DMF   5DP0   5DRJ   5DRM   5DTV   5DU5   5DUE   5DUG   5DUH   5DVS   5DVV   5DWE   5DWG   5DWI   5DWJ   5DX3   5DXB   5DXE   5DXG   5DXK   5DXM   5DXP   5DXQ   5DXR   5DY8   5DYB   5DYD   5DZ0   5DZ1   5DZ3   5DZH   5DZI   5E0W   5E0X   5E14   5E15   5E19   5E1C   5EGV   5EHJ   5EI1   5EIT   5FQP   5FQR   5FQS   5FQT   5FQV   5GS4   5GTR   5HYR   5JMM   5KCC   5KCD   5KCE   5KCF   5KCT   5KCU   5KCW   5KD9   5KR9   5KRA   5KRC   5KRF   5KRH   5KRI   5KRJ   5KRK   5KRL   5KRM   5KRO   5N10   5T0X   5T1Z   5T92   5T97   5TLD   5TLF   5TLG   5TLL   5TLM   5TLO   5TLP   5TLT   5TLU   5TLV   5TLX   5TLY   5TM1   5TM2   5TM3   5TM4   5TM5   5TM6   5TM7   5TM8   5TM9   5TML   5TMM   5TMO   5TMQ   5TMR   5TMS   5TMT   5TMU   5TMV   5TMW   5TMZ   5TN1   5TN3   5TN4   5TN5   5TN6   5TN7   5TN8   5TN9   5TNB   5U2B   5U2D   5W9D  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (7)

Gene RIF (2758)

AA Sequence

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA      1 - 70
QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT     71 - 140
VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK    141 - 210
RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV    211 - 280
GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA    281 - 350
DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG    351 - 420
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM    421 - 490
AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV    491 - 560
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV                                       561 - 595
//

Text Mined References (2715)

PMID Year Title