Property Summary

Ligand Count 978
NCBI Gene PubMed Count 2,688
PubMed Score 8421.58
PubTator Score 11099.47

Knowledge Summary

Patent (299,825)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (14)

Disease log2 FC p
Breast cancer -1.800 1.1e-07
lung cancer -2.000 1.9e-02
adrenocortical carcinoma -1.332 1.8e-03
Atopic dermatitis -1.300 8.8e-04
breast carcinoma 2.000 2.2e-04
cystic fibrosis 1.100 4.9e-04
interstitial cystitis -1.200 4.8e-02
intraductal papillary-mucinous adenoma (... -1.600 4.4e-03
intraductal papillary-mucinous carcinoma... -1.800 2.7e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.9e-02
malignant mesothelioma -1.300 1.1e-04
osteosarcoma -2.199 1.9e-03
pituitary cancer -3.200 5.1e-06
psoriasis -1.100 3.5e-05

Synonym

Accession P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 ER
Symbols ER
ESR
Era
ESRA
ESTRR
NR3A1

Gene

Protein-protein Interaction (7)

PDB (256)

Gene RIF (2758)

AA Sequence

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA      1 - 70
QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT     71 - 140
VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK    141 - 210
RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV    211 - 280
GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA    281 - 350
DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG    351 - 420
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM    421 - 490
AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV    491 - 560
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV                                       561 - 595
//

Text Mined References (2715)

PMID Year Title