Property Summary

NCBI Gene PubMed Count 2,476
PubMed Score 8119.16
PubTator Score 11099.47

Knowledge Summary

Patent (299,825)

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
psoriasis 6685 7.82054876772065E-16
pituitary cancer 1972 5.1466453789786E-6
malignant mesothelioma 3163 1.11201151994766E-4
breast carcinoma 1614 2.22177299861757E-4
cystic fibrosis 1670 4.90645184464679E-4
Atopic dermatitis 944 8.78397164247584E-4
adrenocortical carcinoma 1427 0.00179092292444637
osteosarcoma 7933 0.00194561970153909
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00270524180778566
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00440210574288764
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0186741561112287
interstitial cystitis 2299 0.0480679137016883

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -1.200 0.000
osteosarcoma -2.199 0.002
Atopic dermatitis -1.300 0.001
adrenocortical carcinoma -1.332 0.002
intraductal papillary-mucinous adenoma (... -1.600 0.004
intraductal papillary-mucinous carcinoma... -1.800 0.003
intraductal papillary-mucinous neoplasm ... -1.800 0.019
lung cancer -2.700 0.000
breast carcinoma 2.000 0.000
interstitial cystitis -1.200 0.048
cystic fibrosis 1.100 0.000
Breast cancer -1.800 0.000
pituitary cancer -3.200 0.000

Synonym

Accession P03372 Q13511 Q14276 Q5T5H7 Q6MZQ9 Q9NU51 Q9UDZ7 Q9UIS7 ER
Symbols ER
ESR
Era
ESRA
ESTRR
NR3A1

Gene

PDB

1A52   1AKF   1ERE   1ERR   1G50   1GWQ   1GWR   1HCP   1HCQ   1L2I   1PCG   1QKT   1QKU   1R5K   1SJ0   1UOM   1X7E   1X7R   1XP1   1XP6   1XP9   1XPC   1XQC   1YIM   1YIN   1ZKY   2AYR   2B1V   2B1Z   2B23   2BJ4   2FAI   2G44   2G5O   2I0J   2IOG   2IOK   2JF9   2JFA   2LLO   2LLQ   2OCF   2OUZ   2P15   2POG   2Q6J   2Q70   2QA6   2QA8   2QAB   2QE4   2QGT   2QGW   2QH6   2QR9   2QSE   2QXM   2QXS   2QZO   2R6W   2R6Y   2YAT   2YJA   3CBM   3CBO   3CBP   3DT3   3ERD   3ERT   3HLV   3HM1   3L03   3OS8   3OS9   3OSA   3Q95   3Q97   3UU7   3UUA   3UUC   3UUD   4AA6   4DMA   4IU7   4IUI   4IV2   4IV4   4IVW   4IVY   4IW6   4IW8   4IWC   4IWF   4JC3   4JDD   4MG5   4MG6   4MG7   4MG8   4MG9   4MGA   4MGB   4MGC   4MGD   4O6F   4PP6   4PPP   4PPS   4PXM   4Q13   4Q50   4TUZ   4TV1   4XI3   4ZN7   4ZN9   4ZNH   4ZNS   4ZNT   4ZNU   4ZNV   4ZNW   4ZUB   4ZUC   4ZWH   4ZWK   5AAU   5AAV   5ACC   5AK2   5BNU   5BP6   5BPR   5BQ4   5DI7   5DID   5DIE   5DIG   5DK9   5DKB   5DKE   5DKG   5DKS   5DL4   5DLR   5DMC   5DMF   5DP0   5DRJ   5DRM   5DTV   5DU5   5DUE   5DUG   5DUH   5DVS   5DVV   5DWE   5DWG   5DWI   5DWJ   5DX3   5DXB   5DXE   5DXG   5DXK   5DXM   5DXP   5DXQ   5DXR   5DY8   5DYB   5DYD   5DZ0   5DZ1   5DZ3   5DZH   5DZI   5E0W   5E0X   5E14   5E15   5E19   5E1C   5EGV   5EHJ   5EI1   5EIT   5FQP   5FQR   5FQS   5FQT   5FQV   5HYR  

  Ortholog (12)

MLP Assay (23)

AID Type Active / Inconclusive / Inactive Description
1078 confirmatory 2 / 0 / 22 Estrogen Receptor-alpha Coactivator Binding Inhibitors Reporter Gene Dose Response
1211 screening 71 / 0 / 751 Estrogen Receptor (alpha) binding: Primary Screen
1223 confirmatory 17 / 0 / 46 Estrogen Receptor (alpha) binding: Dose Response of Primary Screen Assay
1226 screening 4 / 2 / 6 Functional assay for estrogen-mediated translocation of PIP3: Secondary Assay for Estrogen receptor alpha
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
602169 other 10 / 0 / 23 Late stage assay provider counterscreen for the probe development effort to identify activators of the Aryl Hydrocarbon Receptor (AHR): Luminescence-based Human Ovarian Carcinoma (BG1Luc4E2) Cell-based assay to identify inhibitors of Estrogen Receptor-Dependent Gene Expression
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (2555)

PMID Text
27434945 ESR1 and VKORC1 single nucleotide polymorphisms were used to determine the vitamin K dosage in patients with ulcer-related hemorrhage.
27174898 Among the proteins reported here, some well-known breast cancer markers (e.g., annexin A1, annexin A2 and vimentin) were identified in the MDA-MB-231 cell line and thus we were able to distinguish both cell lines sufficiently.
27107895 Enhanced KLF17 expression sensitizes ERalpha-positive breast cancer cells to endocrine therapy.KLF17-ERalpha interaction plays a potential role in inhibition of ERalpha-dependent breast cancer progression.
27070141 Three SNPs of the ESR1 gene were not associated with increased BC risk.
27035664 rapid signaling through ERalpha is essential for many of the transcriptional and physiological responses of ECs to E2, and that ERalpha rapid signaling in ECs, in vivo, may be critical for the vasculoprotective and anti-inflammatory effects of estrogen
26960573 Along with the PHF20/MOF complex, G9a links the crosstalk between ERalpha methylation and histone acetylation that governs the epigenetic regulation of hormonal gene expression.
26939421 There was no difference in distribution of polymorphic genes ESR1 and VKORC1 in peptic ulcer hemorrhage patients of both sexes, with the exception of A/A VKORC1 genotype found in women.
26928228 Expression of ESR1, RMND1 and CCDC170 associated with variants in separate enhancer elements predisposing breast cancer. [meta-analysis]
26911590 Genetic variation at the WLS and CCDC170/ESR1 loci were found to be significantly associated with bone mineral density
26846986 In the setting of highly sensitive and robust IHC methodology, cutoffs for ER status determination and subsequent systemic therapy should be revisited.
More...

AA Sequence

MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAYEFNAAAAANA      1 - 70
QVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPFLQPHGQQVPYYLENEPSGYT     71 - 140
VREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFK    141 - 210
RSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEV    211 - 280
GSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLA    281 - 350
DRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG    351 - 420
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLM    421 - 490
AKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASV    491 - 560
EETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV                                       561 - 595
//

Text Mined References (2504)

PMID Year Title
27434945 2016 [HORMONALLY-GENETICALLY DEPENDENT THERAPY, USING VITAMIN K IN PATIENTS, SUFFERING THE ULCER HEMORRHAGE].
27174898 2016 A comparative study of protein patterns of human estrogen receptor positive (MCF-7) and negative (MDA-MB-231) breast cancer cell lines.
27107895 2016 KLF17 attenuates estrogen receptor ?-mediated signaling by impeding ER? function on chromatin and determines response to endocrine therapy.
27070141 2016 A Meta-Analysis of the Association between ESR1 Genetic Variants and the Risk of Breast Cancer.
27035664 2016 ER Alpha Rapid Signaling Is Required for Estrogen Induced Proliferation and Migration of Vascular Endothelial Cells.
26960573 2016 G9a-mediated methylation of ER? links the PHF20/MOF histone acetyltransferase complex to hormonal gene expression.
26939421 2015 [HORMONAL-GENETIC SCREENING IN PATIENTS, SUFFERING GASTRODUODENAL ULCER HEMORRHAGE].
26928228 2016 Breast cancer risk variants at 6q25 display different phenotype associations and regulate ESR1, RMND1 and CCDC170.
26911590 2016 Genome-wide association study using family-based cohorts identifies the WLS and CCDC170/ESR1 loci as associated with bone mineral density.
26846986 2016 Molecular subtype profiling of invasive breast cancers weakly positive for estrogen receptor.
More...