Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.24
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MEAAPSRFMFLLFLLTCELAAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIP      1 - 70
AVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINS     71 - 140
LHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVIS    141 - 210
FFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTPKVEL           211 - 273
//

Text Mined References (12)

PMID Year Title