Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

Synonym

Accession Q5W0A0 Q96MB5
Symbols FAM194B

Gene

  Ortholog (2)

Species Source Disease
OMA EggNOG
OMA EggNOG

 Compartment GO Term (1)

 HCA RNA Cell Line (1)

Gene RIF (2)

AA Sequence

MSAENNQLSGASPPHPPTTPQYSTQNLPSEKEDTEVELDEESLQDESPFSPEGESLEDKEYLEEEEDLEE      1 - 70
EEYLGKEEYLKEEEYLGKEEHLEEEEYLEKAGYLEEEEYIEEEEYLGKEGYLEEEEYLGKEEHLEEEEYL     71 - 140
GKEGYLEKEDYIEEVDYLGKKAYLEEEEYLGKKSYLEEEKALEKEENLEEEEALEKEENLDGKENLYKKY    141 - 210
LKEPKASYSSQTMLLRDARSPDAGPSQVTTFLTVPLTFATPSPVSESATESSELLLTLYRRSQASQTDWC    211 - 280
YDRTAVKSLKSKSETEQETTTKLAPEEHVNTKVQQKKEENVLEFASKENFWDGITDESIDKLEVEDLDEN    281 - 350
FLNSSYQTVFKTIIKEMAAHNELEEDFDIPLTKLLESENRWKLVIMLKKNYEKFKETILRIKRRREAQKL    351 - 420
TEMTSFTFHLMSKPTPEKPETEEIQKPQRVVHHRKKLERDKEWIQKKTVVHQGDGKLILYPNKNVYQILF    421 - 490
PDGTGQIHYPSGNLAMLILYAKMKKFTYIILEDSLEGRIRALINNSGNATFYDENSDIWLNLSSNLGYYF    491 - 560
PKDKRQKAWNWWNLNIHVHAPPVQPISLKINEYIQVQIRSQDKIIFCFTYEQKQICLNLGTRYKFVIPEV    561 - 630
LSEMKKKTILEAEPGPTAQKIRVLLGKMNRLLNYATTPDLENFIEAVSISLMDNKYLKKMLSKLWF        631 - 696
//

Text Mined References (4)

PMID Year Title