Property Summary

NCBI Gene PubMed Count 312
PubMed Score 317.36
PubTator Score 2054.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 1.5506516796589E-20
lung adenocarcinoma 2714 1.02349677953394E-15
lung carcinoma 2844 5.7924110043188E-12
cystic fibrosis 1670 1.90888342806105E-7
breast carcinoma 1614 9.37980205229169E-7
osteosarcoma 7933 2.04624301703209E-5
interstitial cystitis 2299 2.23119131180416E-5
lung cancer 4473 3.73236729991599E-5
ovarian cancer 8492 3.86806983702456E-4
invasive ductal carcinoma 2950 4.5372996469801E-4
nephrosclerosis 329 4.82652569836853E-4
ductal carcinoma in situ 1745 7.89683966044808E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00583353584585517
Breast cancer 3099 0.0120047978575545
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.013482397117533
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0317046643202358
gastric carcinoma 832 0.0422602214807807
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.042 0.000
osteosarcoma -3.020 0.000
cystic fibrosis -2.744 0.000
non-small cell lung cancer -2.081 0.000
intraductal papillary-mucinous adenoma (... -2.000 0.006
intraductal papillary-mucinous carcinoma... -1.800 0.013
intraductal papillary-mucinous neoplasm ... -2.100 0.032
lung cancer -3.400 0.000
breast carcinoma -1.500 0.000
interstitial cystitis 1.600 0.000
lung adenocarcinoma -2.400 0.000
Breast cancer 1.500 0.012
lung carcinoma -2.000 0.000
gastric carcinoma 1.100 0.042
ductal carcinoma in situ -1.300 0.001
invasive ductal carcinoma -2.100 0.000
ovarian cancer -1.100 0.000

Synonym

Accession P11308 B4DTW5 B4E0T4 Q16113 Q6XXX4 Q6XXX5 Q8IXK9
Symbols p55
erg-3

Gene

ERG

PANTHER Protein Class (1)

PDB

1SXE   4IRG   4IRH   4IRI  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624246 confirmatory 102 / 2370 / 367942 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction
624266 summary 0 / 0 / 0 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction: Summary.
651803 confirmatory 0 / 9 / 1227 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction: TR assay against cherry picks
651804 confirmatory 20 / 286 / 930 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction: HTRF assay against cherry picks

Gene RIF (282)

PMID Text
26986253 Free testosterone was significantly associated with the risk of ERG-positive prostate cancer.
26978019 The relatively low rate of ERG-positive prostatic intraepithelial neoplasia counts in favor of the limited role of chimeric transcript TMPRSS2/ERG in the differential diagnosis of prostatic intraepithelial neoplasia
26743468 Approx 25% of discontinuously involved prostate biopsy cores showed tumor foci with discordant ERG/SPINK1 status, consistent with multiclonal disease.
26690869 prevalence of the FUS-ERG gene fusion in a large cohort of pathologically and molecularly well characterized small blue round cell tumors, lacking other known gene rearrangements
26684029 ERG-fusion can precede 6q15 deletion and result in prostate cancer.
26653555 miR-30b was involved in the process of osteoarthritis, and it probably functioned through its target gene ERG
26625814 BAALC and ERG genes are specific significant molecular markers in acute myeloid leukemia disease progression, response to treatment and survival.
26615022 The potential for TMPRSS2:ERG gene fusion, detected by IHC, to modify the role of PTEN loss in lethal progression of prostate cancer.
26554849 Data iindicate a different ratio of active transcription factor ERG's to ERG isofoprm ERG8 in cancer- versus non-transformed cells.
26542308 Results suggest that acquired gain of chromosome 21 or amplification of chromosome arm 21q is one mechanism contributing to increased ERG expression in acute myeloid leukemia.
More...

AA Sequence

MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPAR      1 - 70
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTL     71 - 140
WSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHL    141 - 210
TSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAA    211 - 280
QPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTD    281 - 350
PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS    351 - 420
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY        421 - 486
//

Text Mined References (315)

PMID Year Title
26986253 2016 Pre-diagnostic circulating sex hormone levels and risk of prostate cancer by ERG tumour protein expression.
26978019 [Diagnostic value of estimation of ERG expression in prostate adenocarcinoma and high-grade prostatic intraepithelial neoplasia].
26743468 2016 Clonal evaluation of prostate cancer foci in biopsies with discontinuous tumor involvement by dual ERG/SPINK1 immunohistochemistry.
26690869 2016 Ewing sarcoma with ERG gene rearrangements: A molecular study focusing on the prevalence of FUS-ERG and common pitfalls in detecting EWSR1-ERG fusions by FISH.
26684029 2016 Heterogeneity and chronology of 6q15 deletion and ERG-fusion in prostate cancer.
26653555 2015 Elevated expression of microRNA-30b in osteoarthritis and its role in ERG regulation of chondrocyte.
26625814 2015 Relation of BAALC and ERG Gene Expression with Overall Survival in Acute Myeloid Leukemia Cases.
26615022 2016 A Prospective Investigation of PTEN Loss and ERG Expression in Lethal Prostate Cancer.
26554849 2016 Sequence-function correlations and dynamics of ERG isoforms. ERG8 is the black sheep of the family.
26542308 2016 Gain of chromosome 21 or amplification of chromosome arm 21q is one mechanism for increased ERG expression in acute myeloid leukemia.
More...