Property Summary

NCBI Gene PubMed Count 312
PubMed Score 317.36
PubTator Score 2054.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
nephrosclerosis 1.042 4.8e-04
osteosarcoma -3.020 2.0e-05
cystic fibrosis -2.744 1.9e-07
non-small cell lung cancer -2.081 1.6e-20
intraductal papillary-mucinous adenoma (... -2.000 5.8e-03
intraductal papillary-mucinous carcinoma... -1.800 1.3e-02
intraductal papillary-mucinous neoplasm ... -2.100 3.2e-02
lung cancer -3.400 3.7e-05
breast carcinoma -1.500 9.4e-07
interstitial cystitis 1.600 2.2e-05
lung adenocarcinoma -2.400 1.0e-15
Breast cancer 1.500 1.2e-02
lung carcinoma -2.000 5.8e-12
gastric carcinoma 1.100 4.2e-02
ductal carcinoma in situ -1.300 7.9e-04
invasive ductal carcinoma -2.100 4.5e-04
ovarian cancer -1.100 3.9e-04

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
624246 confirmatory 102 / 2370 / 367942 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction
624266 summary 0 / 0 / 0 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction: Summary.
651803 confirmatory 0 / 9 / 1227 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction: TR assay against cherry picks
651804 confirmatory 20 / 286 / 930 qHTS for Small Molecule Inhibitors of the ERG Ets/DNA interaction: HTRF assay against cherry picks

Gene RIF (282)

PMID Text
26986253 Free testosterone was significantly associated with the risk of ERG-positive prostate cancer.
26978019 The relatively low rate of ERG-positive prostatic intraepithelial neoplasia counts in favor of the limited role of chimeric transcript TMPRSS2/ERG in the differential diagnosis of prostatic intraepithelial neoplasia
26743468 Approx 25% of discontinuously involved prostate biopsy cores showed tumor foci with discordant ERG/SPINK1 status, consistent with multiclonal disease.
26690869 prevalence of the FUS-ERG gene fusion in a large cohort of pathologically and molecularly well characterized small blue round cell tumors, lacking other known gene rearrangements
26684029 ERG-fusion can precede 6q15 deletion and result in prostate cancer.
26653555 miR-30b was involved in the process of osteoarthritis, and it probably functioned through its target gene ERG
26625814 BAALC and ERG genes are specific significant molecular markers in acute myeloid leukemia disease progression, response to treatment and survival.
26615022 The potential for TMPRSS2:ERG gene fusion, detected by IHC, to modify the role of PTEN loss in lethal progression of prostate cancer.
26554849 Data iindicate a different ratio of active transcription factor ERG's to ERG isofoprm ERG8 in cancer- versus non-transformed cells.
26542308 Results suggest that acquired gain of chromosome 21 or amplification of chromosome arm 21q is one mechanism contributing to increased ERG expression in acute myeloid leukemia.
26517642 prognostic power of proliferation markers PHH3 and Ki-67 was markedly enhanced in ERG translocation negative
26503111 Aspirin was associated with a significant reduction in the relative risk of TMPRSS2:ERG (T2E )fusion positive, but not T2E negative
26452381 We examined the correlation of clinicopathological factors and prognosis with ERG and the TMPRSS2-ERG fusion oncogene and ERG expression as predictive markers--REVIEW}
26424596 Results indicate that PTEN loss occurs in cooperation with TMPRSS2-ERG fusion in prostate cancer and the majority of the samples harbor TMPRSS2-ERG fusion as well as PTEN gene deletion.
26345389 A molecular signature of PCA3 and ERG exosomal RNA from non-DRE urine is predictive of initial prostate biopsy result
26344096 Overcoming ERG resistance to SPOP-mediated degradation represents a viable strategy for treatment of prostate cancers expressing either mutated SPOP or truncated ERG.
26344095 SPOP functions as a tumor suppressor to negatively regulate the stability of the ERG oncoprotein in prostate cancer.
26310325 Data indicate that ERG has effects on cell metabolism and proliferation by increasing cell responsiveness to exogenous neurotransmitter receptor agonists such as nicotine, and possibly to endogenous neurotransmitters.
26294063 TMPRSS2-ERG expression was detected in carcinoma foci, regions next to them, and in samples not adjacent to carcinoma foci; Molecular changes outside the carcinoma foci are also indicated for PCA3.
26261664 Case Report: SMARCB1-deficient vulvar sarcoma expressing ERG and FLI1.
26178158 ERG expression was significantly less common among prostatic ductal adenocarcinomas compared to acinar carcinomas.
26174629 Upregulation of ERG in 32D cells rescued miR-9/9*-induced block in neutrophil differentiation
26172920 neither ERG nor SPINK1 appear to be useful biomarkers for prognostication of early stage prostate cancer
26159617 We conclude that flecainide accesses the hERG channel from the cell interior on channel gating, binding low in the inner cavity, with the S6 F656 residue acting as a principal binding determinant.
26148230 FUS-ERG is a transcriptional repressor of retinoic acid signaling. It acts in the context of a heptad of proteins (ERG, FLI1, GATA2, LYL1, LMO2, RUNX1 and TAL1) central to proper expression of genes maintaining a hematopoietic stem cell phenotype.
26097038 Articular cartilage endurance and resistance to osteoarthritic changes require transcription factor Erg.
26063314 Overexpression of FLI1 and ERG genes is sufficient to transdifferentiate erythroblasts to megakaryocytes that can produce functional platelets.
26060265 Biopsies can be used reliably to investigate ERG's prognostic and predictive value in prostate neoplasms.
26058078 ERG activates the transcriptional program regulated by YAP1 of the Hippo signaling pathway and found that prostate-specific activation of either ERG or YAP1 in mice induces similar transcriptional changes and results in age-related prostate tumors.
26053696 ERG expression was not associated with risk of castration-resistant prostate cancer.
26030748 results of our study argue against a tumor-promoting role of SOX9 in prostate cancer, but demonstrate that loss of SOX9 expression characterizes a particularly aggressive subset of ERG positive cancers harboring PTEN deletion
26026052 The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition
25977336 Analysis of prostate cancer tissues showed that the presence of a TMPRSS2-ERG rearrangement was highly correlated with lower levels of NKX3.1 expression consistent with the role of NKX3.1 as a suppressor of the pathogenic gene rearrangement.
25972242 ERG expression is variable in prostate cancer and is associated with activation of multiple pathways and proteins including several potentially targetable pathways.
25933120 Genetic inhibition of TMPRSS2-ERG junction oncogene in prostate cancer by means of siRNA has strong antineoplastic effect in a mouse model and in vitro.
25915839 The role of ERG oncogene in prostate cancer
25899828 ERG-positive tumors increase in proportion with increasing stage of disease, but strength of ERG expression in ERG-positive patients shows a significant decline, or "loss," in patients with stage 4 disease.
25897494 ERG overexpression was associated with favorable recurrence-free survival after radical prostatectomy for prostate cancer, whereas PTEN loss was associated with unfavorable outcomes.
25889691 ERG protein quantification methods can be of use in the diagnosis of prostate cancer.
25885538 ERG overexpression drives migration of prostate cells with low levels of RAS/ERK signaling, while ETS1 has a similar function only when RAS/ERK signaling is high
25881913 Our results show that ERG is a novel, reliable, and specific marker for endothelial cells within central nervous system tumors that can be used to better study the process of neovascularization
25852077 recent and maximum BMI are inversely associated with the odds of developing T2E-positive prostate cancer, but no associations were observed for T2E-negative prostate canc
25754347 Elucidation of ERG regulation of ABEs in castration-resistant prostate cancer (CRPC) may help to stratify TMPRSS2-ERG fusion-positive prostate cancer patients in the clinic for anti-androgen receptor-driven therapies.
25728532 Results provide suggestive evidence that men with TMPRSS2:ERG positive tumors may have longer prostate cancer survival after ADT.
25724568 heterogeneity of ERG and PTEN is critical for developing optimal yet cost-effective strategies to identify these underlying molecular abnormalities of prostate cancer
25639219 ERG and TFF3 expression characterize 2 distinct subsets of prostate cancer, with a more aggressive subgroup of TFF3-expressing tumors that express SPINK1.
25517865 ERG IHC is of limited additional diagnostic value when added to AMACR and CK5/6. ERG expression is inversely related to GS and is associated with bilateral involvement and higher PCA tumor volume.
25479928 the evaluation of ERG and SALL4 immunoexpressions may be a useful diagnostic tool to distinguish epithelioid sarcoma, especially proximal type, from malignant rhabdoid tumor
25420520 ERG overexpression of castration-resistant prostate cancer is associated with decreased sensitivity to taxanes.
25378537 Characterise the expression of ERG in mesenchymal tumours and found relatively constant nuclear ERG expression in selected chondrogenic tumours.
25352641 for the cytological diagnosis of angiosarcomas, ERG and CD31 are more sensitive vascular markers than CD34
25344575 Results show the transcriptional repression of ANXA2 by ERG in prostate epithelial cells plays a critical role in abrogating differentiation, promoting epithelial-mesenchymal transition, and in the inverse correlation of expression seen in prostate tumor.
25306899 Overexpression of ERG in cord blood progenitors promotes expansion and recapitulates molecular signatures of high ERG leukemias.
25263440 Data indicate that inhibition of transcriptional regulator ERG protein expression in transmembrane protease serine 2 protein (TMPRSS2):ERG-positive prostate cancer cells increased neuroendocrine cell gene expression.
25239421 ERG mRNA and protein expression is increased in patients with advanced prostate cancer, with higher levels of ERG expression associated with seminal vesicle invasion and biochemical recurrence; there is a clear indication of increased retention of exons 10 and 11 in prostate cancer
25220615 ERG expression and microvessel density may have a significant relationship in prostatic adenocarcinoma.
25175909 results demonstrate the ability of confocal microscopy and FISH to identify the cell-to-cell differences in common gene fusions such as TMPRSS2-ERG that may arise independently within the same tumor focus
25175352 ERG expression is less frequent in PCa from patients of African descent. Although ERG expression increases during PCa natural history, positive ERG status is associated with better outcome in both CLC and CRPC
25170998 A minimal epitope (RVPQQDWL) within residues 42-66 of ERG, recognized by MAb 9FY, may aid in the diagnosis and antibody based therapeutics against prostate and other cancers showing ERG overexpression.
25062690 ERG and APLNR are essential for endothelial homeostasis in venules in the lung and that perturbation in ERG-APLNR signaling is crucial for the development of pulmonary veno-occlusive disease.
25043536 At baseline, mRNA expression of TMPRSS2-ERG in castration-resistant prostate cancer patients is elevated.
25043157 Tissue microarray of tumor sites from prostate cancer patients correlates with ERG, prostate-specific antigen (PSA), and androgen receptor (AR) expression and ERG gene rearrangement.
25015038 these data show that the androgen-driven events causing TMPRSS2-ERG fusions and other rearrangements of androgen-dependent genes in prostate epithelial cells of young patients preferentially lead to low-grade (and not high-grade) prostate cancer.
25007891 Both IHC and qRT-PCR are useful tools in detecting TMPRSS2:ERG fusions.
24997128 TMPRSS2-ERG fusion gene transcript was found in 63, 55 and 73% of the prostate cancer cases on urine alone, biopsy rinse material alone and paired samples, respectively.
24972028 Combined ERG/AR overexpression signifies a class of patients at highest-risk of prostate cancer specific mortality with specific key genetic alteration likely responsible for disease progression.
24961351 These findings indicate that TMPRSS2-ERG may or may not lead to prostate cancer development.
24931216 concurrent in situ detection of gene expression, point mutations, and gene fusions of the prostate cancer relevant targets TMPRSS2-ERG
24926821 TMPRSS2:ERG gene fusion synergizes with the VDR to induce CYP24A1 expression-limiting VDR signaling.
24925673 data suggest that shorter androgen receptor CAG repeats are specifically associated with development of TMPRSS2:ERG-positive prostate cancer.
24909781 The 98.08% specificity of ERG oncoprotein for prostate tumor cells combined with its increased association in advanced disease, suggests for prognostic potential of ERG that may aid clinicians in treatment decisions for Filipino prostate cancer patients.
24796295 The study results suggest that ERG expression may be of added prognostic value in localized prostate cancer in patients with early onset prostate cancer
24789172 Our observations indicate a tight link of NY-ESO-1 expression to ERG activation
24777847 High AR gene copy number emerges during the development of Small cell carcinoma of the prostate, often in association with TMPRSS2-ERG rearrangement.
24762546 The observation that PTEN alterations develop subsequent to ERG fusion strongly suggests that ERG expression may directly drive development of PTEN aberrations in prostate cancer
24707153 ERG is a more sensitive and specific diagnostic marker for hepatic angiosarcoma in comparison to CD31, CD34 and FVIIIRAg
24705308 ERG immunohistochemistry is potentially indicated only in uncommon cases of minimal prostate adenocarcinoma when AMACR staining is negative or weak, and in these cases ERG is informative in only a minority (29%) of cases.
24504051 This report provides mechanistic clues into ERG-driven drug resistance in the poor prognostic group of high ERG expressers.
24469092 Data identified a subgroup of ERG-rearranged CR PCs without detectable ERG protein expression. Our results suggest that this subgroup could represent CR PCs with a dispensed AR pathway.
24435928 ERG regulated SOX4 expression via binding to its promoter. Silencing both of them showed duplicate effects on restoring the epithelial characteristics, increasing cellular adhesion and decreasing capacity of cellular migration and invasion.
24418414 These observations imply that the frequently noted loss-of-function of NKX3.1 cooperates with the activation of TMPRSS2-ERG fusions in prostate tumorigenesis.
24406865 Intraductal carcinoma of the prostate has 100% concordance of ERG positivity with adjacent conventional prostatic adenocarcinoma.
24380696 The tight link to ERG activation and PTEN deletions suggest interaction with key molecular pathways in prostate cancer.
24334129 hERG/R148W alone produced a current similar to the WT.
24306662 Low ERG expression is associated with hepatocellular carcinoma.
24297949 Patients with ERG expression were more likely to develop PCa, with 27 (53%) of 51 ERG-positive and 143 (35%) of 410 ERG-negative patients experiencing progression to PCa.
24292212 Results suggest that obesity is linked with poorer prostate cancer prognosis primarily in men with tumors harboring the gene fusion TMPRSS2:ERG.
24195515 ERG expression correlates with occurrence of TMPRSS2-ERG fusion and with androgen receptor-driven malignant transformation.
24186205 miR-200c is the first miRNA target of ERG protein and a critical inhibitor of prostate cancer cell motility.TMPRSS2-ERG gene fusions induce prostate tumorigenesis by modulating microRNA miR-200c.
24115221 In prostate tumors, ERG expression is a useful biomarker for tumor cell growth and differentiation.
24072184 Report prognostic value of tissue/urinary TMPRSS2-ERG levels in prostate neoplasms.
24072183 Report ERG expression in epithelioid sarcomas.
24072102 ERGdel could compromise the potentially oncogenic effect of wild-type ERG resulting in a negative effect on disease aggressiveness
24064621 within patients with an IKZF1 Delta4-7 deletion, those with ERG(del) had a better outcome
24006850 a molecular signature reflective of the downstream effects of ERG-mediated transcriptional regulation with prognostic implication in patients with prostate cancer (PCA).
23974202 The importance of the ERG/PIM1 axis is further underscored by the poorer prognosis of acute myeloid leukemia highly expressing ERG and PIM1.
23918819 Data demonstrate that ERG activates CXCR4 expression by binding to specific ERG/Ets responsive elements and via intracellular kinases that phosphorylate ERG at discrete serine residues.
23913826 High ERG expression is associated with prostate cancer.
23898196 The allosteric basis of ERG autoinhibition is mediated predominantly by the regulation of Ets-domain dynamics with only modest structural changes.
23887154 TMPRSS2-ERG rearrangements were not identified in Atypical adenomatous hyperplasia
23856515 Distinct ERG and TFF3 protein was expressed in 45% (43/96) and 36% (35/96) of prostate cancers, respectively.
23850495 Frequent TMPRSS2-ERG rearrangement occurs in prostatic small cell carcinoma as detected by fluorescence in situ hybridization.
23849895 ERG is expressed in almost 50% of cases of mucinous prostatic adenocarcinoma and prostatic adenocarcinoma with mucinous features, similar to rates of expression in conventional prostatic adenocarcinoma.
23817021 Expression of ERG and ETV1 correlated with higher AR transcriptional output in PTEN-deficient prostate cancer specimens.
23797726 ERG immunohistochemistry could be considered in a second round of immunostaining of select difficult cases of foamy gland carcinoma of the prostate with low AMACR expression.
23794398 Recurrent deletion of 3p13 targets multiple tumour suppressor genes and defines a distinct subgroup of aggressive ERG fusion-positive prostate cancers.
23781502 No association between TMPRSS2-ERG status and clinicopathological parameters nor biochemical progression and clinical progression free survival was found.
23774169 ERG expression is fairly common in epithelioid sarcoma and should be recognized as a diagnostic pitfall in the differential diagnosis of epithelioid sarcoma and epithelioid angiosarcoma
23728339 We have demonstrated that ERG is a direct target of miR-30
23703293 Strong ERG protein expression was exclusively detected in prostate carcinomas, corroborating the specificity of ERG rearrangements for these tumors.
23701505 TMPRSS2-ERG rearrangement occurs in dominant transition zone (TZ) and anterior peripheral zone prostate cancers, with all rearranged TZ cancers in this cohort showing deletion.
23686669 The expression of ERG was higher in the CAC group when compared to OCC and BPH (p = 0.7684, p = 0.0224, respectively).
23653096 ERG overexpression is associated with greater risk of capsular penetration in prostate cancer.
23642739 DAXX appears to exert biologically different effects in ERG-positive and ERG-negative prostate cancers.
23578236 ETS expression by itself outmatched the diagnostic performance of the ERG exons ratioing allowing equal detection of the less frequent ETS gene fusion transcripts.
23555854 ERG induces epigenetic activation of Tudor domain-containing protein 1 (TDRD1) in ERG rearrangement-positive prostate cancer.
23554889 Celastrol can significantly inhibit the growth of T/E fusion expressing PCa cells both in vitro and in vivo through targeting three critical signaling pathways: AR, ERG and NF-kB in these cells.
23546179 A novel hERG frameshift mutation (hERG(DeltaAT)) in the S5-pore region from a LQTS patient who died suddenly and analyzed its genetic profile and the molecular and electrophysiological behaviors of the protein product to assess the pathogenicity of hERG(DeltaAT).
23545904 PTEN loss tends to occur as a subclonal event within a given established prostatic carcinoma clone after ERG gene fusion.
23535644 presence and expression of TMPRSS2/ERG in prostate stem cells would provide ERG-driven survival advantages, allowing maintenance of this mutated genotype
23480797 Down-regulation of miR-145 may contribute to the increased expression of most ERG splice variants sharing the miR-145 target sequence in their 3' untranslated region.
23472063 characterization of native ERG and Tmprss2:ERG variants reveals that their different oncogenic potential is affected by the status of the Ets domain and the configuration of the 5' UTR region
23462600 ERG is a highly specific marker, which may have important implications in the interpretation of prostate biopsies with limited cancers.
23459095 ERG and TATI are not co-expressed in the same prostatic tumor cells.
23447416 Nucleotide resolution analysis of TMPRSS2 and ERG rearrangements show strong clustering in specific intronic regions in prostate cancer.
23426182 In prostate cancer, ERG redirects androgen receptor to a set of genes including SOX9 that are not normally androgen stimulated.
23390522 Robust population-independent transcriptional changes in prostate cancer include ERG rearrangements inducing metabolic changes in cancer cells by activating major metabolic signaling molecules like neuropeptide Y.
23381693 Acceleration of tumor development by ERG overexpression results in earlier tumor detection in young patients.
23380710 Gata1 mutant cells that overexpress ERG with hyperactive AKT are characterized by diminished FOXO1/3a expression and an increased dependency on the c-Jun pathway
23352841 Analysis using the four-color FISH assay provides sensitive detection of TMPRSS2 and ERG gene rearrangements in prostate cancer.
23348902 Automated dual ERG-PTEN and ERG-SPINK1 immunohistochemisty assays are simple, reliable and portable across study sites for the simultaneous assessment of these proteins in prostate cancer.
23334893 The composite score for ERG expression was prognostic for the development of biochemical relapse, metastases, and prostate cancer specific mortality.
23327922 Transcriptional regulators cooperate to establish or maintain primitive stem cell-like signatures in leukemic cells.
23319146 TDRD1 is the first identified upregulated direct ERG target gene that is strongly associated with ERG overexpression in primary prostate cancer
23300998 ERG has a role in deregulated kinase signaling in acute leukemias
23250622 ERG expression might serve as a molecular marker for risk stratification in acute promyelocytic leukemia.
23158212 ERG positivity in small atypical glands where high-grade prostatic intraepithelial neoplasia diagnosis is excluded helps establish a definitive cancer diagnosis in a small proportion of additional atypical glands suspicious for cancer cases
23027626 ILK is a therapeutically targetable mediator of ERG-induced epithelial-to-mesenchymal transition (EMT) and transformation in prostate cancer.
22993300 The transmembrane protease, serine 2:ets-related gene (TMPRSS2:ERG) gene fusion leads to the overexpression of ERG, an E-twenty six (ETS) family transcription factor, and is the most prevalent genetic lesion in prostate cancer.
22930729 This work uncovers significant global epigenetic alterations in TMPRSS2-ERG gene fusion-negative tumors and provides a mechanistic explanation for the tumor formation process.
22922762 In prostate cancer, ERG is part of a complex integrated transcriptional network that involves ETS2 and ETV4.
22899295 the results of this study show that ERG overexpression is often heterogeneous in prostate cancer
22886792 Loss of pSer2448-mTOR expression is linked to adverse prognosis and tumor progression in ERG-fusion-positive cancers.
22869147 study found that activator protein 1 (AP-1), Ets related gene (Erg) and glucocorticoid receptor pathways were differentially regulated in sensitive and resistant acute lymphoblastic leukemia.
22860005 TMPRSS2-ERG fusion accelerates prostatic intraepithelial neoplasia development but not progression to adenocarcinoa.
22821757 study provides first evidence that expression of SLC45A3 protein is downregulated through SLC45A3-ERG fusion in prostate cancer; study confirms ERG protein expression is predominantly found in prostate carcinomas with ERG gene rearrangement and does not occur in benign glands
22767266 The ERG rearrangement occurred at a lower frequency in distant metastatic prostate cancer compared to local recurrent castration-resistant prostate cancer.
22745159 Modulation of hERG potassium channel gating normalizes action potential duration prolonged by dysfunctional KCNQ1 potassium channel.
22736790 TMPRSS2:ERG, or ERG overexpression, is associated with tumor stage but does not strongly predict recurrence or mortality among men treated with radical prostatectomy.
22716285 ERG is a highly sensitive and specific marker for cutaneous angiosarcoma, and typically shows strong, diffuse nuclear staining. Immunohistochemistry for ERG is therefore useful to support the diagnosis of cutaneous angiosarcoma of the head and neck.
22705054 Deletion of PTEN is associated with tumor progression and early PSA recurrence in ERG fusion-positive and fusion-negative prostate cancer
22696228 Data suggest that measuring ERG rearrangement could be used for assessing the risk of lymph node metastasis in early prostate cancer.
22674214 TMPRSS2/ERG gene fusion is found in benign prostatic hyperplasia and normal prostate but is significantly increased in prostate cancer samples.
22615383 Erg oncogenic transcription factor overexpression is associated with global, reproducible, and functionally coherent changes in chromatin organization.
22505341 Prostate specimens and urine sediments from 179 previously untreated patients with pT2-pT3 stage PCa were analyzed for expression of telomerase (TERT and TR) and the TMPRSS2-ERG fusion gene by means of reverse transcription PCR.
22488406 A high MEBE (MN1,ERG, BAALC, EVI1) expression score is an unfavorable prognostic marker in Myelodysplastic syndrome and is associated with an increased risk for progression to Acute myeloid leukemia.
22463702 The high specificity of ERG expression in both normal and neoplastic tissues suggests a very narrow biological role for ERG in highly selected tissues.
22337883 Erg prevents NF-kappaB p65 from binding to the ICAM-1 promoter, suggesting a direct mechanism of interference.
22331093 The robust correlation between ERG oncoprotein detection and gene fusion status enables rapid characterization of this protein in large patient cohorts with prostate cancer.
22313860 Blood mRNA levels of prostate cancer genes may represent a novel aspect of monitoring prostate cancer and have implications for the understanding of tumour-derived mRNA
22300588 ERG protein levels may have prognostic and therapeutic role in prostate cancer and should be investigated in future studies.
22245323 The only 2 true prostate cancer specific biomarkers identified to date remain PCA3 and TMPRSS2:ERG gene fusion.
22235125 ERG plays a pivotal role in regulating endothelial cell barrier function and that this effect is mediated in part through its regulation of CLDN5 gene expression.
22221250 Amplified segment in the 'Down syndrome critical region' on HSA21 shared between Down syndrome and euploid AML-M0 excludes RUNX1, ERG and ETS2.
22080055 Immunohistochemical ERG expression has no predictive value for prostate cancer recurrence or progression after radical prostatectomy.
22076164 Suggest that the oncogenic gene fusion TMPRSS2:ERG does not occur in ovarian cancer relative to prostate cancer.
21946329 ERG promoter methylation is common and associated with prostate cancer.
21937078 This study demonstrates a close relationship of the TMPRSS2-ERG gene fusion status between primary and metastatic prostate cancer.
21835957 Low ERG and BAALC expression (E/B(low)) and NOTCH1/FBXW7 (N/F) mutations have been proposed as powerful prognostic markers in large cohorts of adult T-ALL.
21802835 Prostate specific TMPRSS2-ERG fusion was found in circulating tumor cells but did not predict for response to abiraterone acetate treatment.
21791629 The striking similarities between these two types of prostate cancers rules out a major impact of ERG on tumor aggressiveness in early, not hormonally treated cancer.
21743959 TFF3, TMPRSS2 and ERG were up-regulated in the prostate carcinoma glands compared to the corresponding normal glands.
21743434 TMPRSS2-ERG fusion was not prognostic for recurrence after retropubic radical prostatectomy for clinically localized prostate cancer, although men with ERG gene copy number gain without fusion were twice more likely to recur.
21731703 Downregulation of PSMA in androgen-treated VCaP cells appears partially mediated by TMPRSS2-ERG gene fusion.
21707844 Our study demonstrates that the clinical utility of ERG detection at the protein level can serve as an ancillary tool for diagnosing prostate cancer in the Japanese population.
21680704 BR-DIM and CDF inhibited the signal transduction in the AR/TMPRSS2-ERG/Wnt signaling network, leading to the inactivation of Wnt signaling consistent with inhibition of prostate cancer cell invasion
21677539 We found that ERG immunohistochemical expression has a high accuracy for defining the TMPRSS-ERG fusion status.
21676887 Knockdown of TMPRSS2-ERG in VCaP cells resulted in the downregulation of wild-type ERG transcription, whereas stable overexpression of TMPRSS2-ERG in the gene fusion-negative PC3 cells was associated with the upregulation of wild-type ERG transcript
21669963 OPN is an ERG-target gene in PCa where the abnormal expression of the transcription factor ERG, due to the TMPRSS2:ERG fusion, disturbs the expression of genes that play an important role in PCa cells and associated metastases.
21664289 the role of ERG in normal and aberrant blood development will be discussed as well as the possibilities to therapeutically target this ETS factor. [Review]
21623182 The P63/ERG double immunostain combines the high sensitivity of P63 and the high specificity of ERG and may be potentially useful in the work-up of difficult prostate biopsies.
21600800 Data indicate combining serum PSA, PCA3, and TMPRSS2:ERG in a multivariable algorithm optimized for clinical utility improved cancer prediction.
21584900 TMPRSS2-ERG fusion gene status and relative 8q gain were assessed by fluorescent in situ hybridization in whole formalin fixed paraffin-embedded biopsies
21559405 ERG and ETV1 mediated prostate cancer cell invasion is inhibited by YK-4-279
21536859 Data indicate that ERG promotes proliferation of T-acute lymphoblastic leukemia (T-ALL) lymphoblasts; ERG promoter region (ERG +85 enhancer; sequence alignment given) is active in T-ALL lymphoblasts and is regulated by oncogenes (SCL, LYL1, LMO2).
21499238 TMPRSS2-ERG gene fusion was found in prostatic small cell carcinoma and adenocarcinoma, but was absent in bladder small cell carcinoma
21474234 the expression of TMPRSS2(exon 0):ERG fusion transcripts, alone or in combination with TMPRSS2(exon 1):ERG expression, is associated with a favorable prognosis of primary prostate cancer
21394739 The effect of TMPRSS2/ERG gene fusions had differing effects on radiosensitivity and chemosensitivity depending on cell line and fusion type.
21383613 ERG immunohistochemistry is not useful for stratifying "atypical glands suspicious for cancer" prostate biopsies to identify patients who have increased risk for prostate adenocarcinoma in repeat biopsies.
21317715 ERG is a highly specific new marker for benign and malignant vascular tumors
21249148 the Per-Arnt-Sim domain is bound close to the central core of the channel and the N-terminal alpha-helix ensures that the flexible tail is correctly orientated for interaction with the activation gating machinery to stabilize the open state of the channel
21242973 WNT11 emerged as a direct target of ERG.
21178509 The differences of ERG and /or PTEN genetic aberrations in transition zone tumors may point toward a subset of tumors with adverse behavior.
21170267 ERG has an inhibitory effect on TFF3 expression in hormone-naive prostate cancer but not in castration-resistant state; TFF3 enhances ERG-mediated cell invasion in castration-resistant prostate cancer cells resulting in enhanced tumor cell aggressiveness
21169414 Activation of NF-{kappa}B by TMPRSS2/ERG Fusion Isoforms through Toll-Like Receptor-4.
21167530 ERG fusion was detected in 68% of prostatic tumors. Cases rearranged via deletion had significantly higher tumor volume.
21062978 Data show that the prognostic abilities of TOP2A and MIB-1 were significantly better in ERG(-) patients.
21040948 we demonstrate that most human prostatic small cell carcinomas carry the TMPRSS2-ERG gene fusion, confirming the involvement of this gene fusion in prostatic SCC.
20966395 Have identified a novel physiological anti-inflammatory pathway under the control of the transcription factor Erg; this pathway inhibits NF-kappaB-dependent transcription and TNF-alpha-induced inflammation in vivo.
20860828 cortical cytoskeletal and extracellular matrix gene expression changes in prostate cancer are related to oncogenic ERG deregulation
20841507 High ERG expression levels are associated with acute myeloid leukemia.
20800881 Prostate cancer with large cribriform glands revealed rare TMPRSS2-ERG gene fusion
20798944 The recent discovery and subsequent characterization of recurrent gene rearrangements of ETS genes - most frequently ERG - in the majority of prostate cancers is a milestone in translational prostate cancer research.
20713528 Results provide mechanistic insights to ERG oncogenesis in prostate cancer, involving activation of WNT signaling through FZD4, leading to cancer-promoting phenotypic effects, including EMT and loss of cell adhesion.
20693982 Although ERG rearrangement is more common in peripheral zone tumors, we have detected TMPRSS2-ERG fusion in a subset of transition zone cancers.
20676125 a self-sustaining triad of LMO2/ERG/FLI1 stabilizes the expression of important mediators of the leukaemic phenotype such as
20651988 Given the ease of performing IHC versus FISH, ERG protein expression may be useful for molecularly subtyping prostate cancer based on ERG rearrangement status and suggests clinical utility in prostate needle biopsy evaluation.
20590547 Results highlight the co-operation and importance of ERG gene rearrangements and PTEN deletions as significant drivers of prostate cancer development and progression.
20585344 Overexpression of ERG is associated with prostate cancer progression.
20570349 results identify miR-196a and miR-196b as ERG regulators and implicate a potential role for these miRNAs in acute leukemia
20562851 These findings indicate that translocation/deletion of TMPRSS2-ERG is not associated with histological features of aggressive prostate cancer
20546020 higher ERG expression in NPM1-unmutated patients than in NPM1-mutated patients. The level of ERG expression had no independent effect on the survival in normal karyotype AML patients
20526358 The mechanism of slow activation of human ERG channels was investigated using fluorescence as a direct measure of S4 movement and pore opening.
20478527 findings provide a working model in which TMPRSS2-ERG plays a critical role in cancer progression by disrupting lineage-specific differentiation of the prostate
20473283 We hypothesize that the ERG rearrangement as well as the distinct deletion site on 21q22.2-3 between TMPRSS2 and ERG are prostate-cancer-specific genomic alterations.
20442300 There was no association between TMPRSS2:ERG fusion and prognosis in prostate cancer patients primarily treated by endocrine therapy
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20308673 Propsectively evaluated the impact of EWS-FLI1/ERG fusions on disease progression in Ewing's sarcoma/peripheral primitive neuroectodermal tumor.
20308669 Intensive treatment protocols for localized Ewing family sarcoma have erased the clinical differences observed in patients with EWS-FLI1/ERG fusions.
20303538 TMPRSS2-ERG fusion gene status classifies patients with prostate cancer treated with radical prostatectomy into groups defined by different prognostic factors.
20160063 A higher urine ERG score in post-digital rectal exam urine is associated with the diagnosis of prostate cancer on biopsy
20118910 This is the first study to describe the frequency of SLC45A3-ERG fusions in a large clinical cohort of prostate cancer patients
20104229 ERG/ETV1 gene rearrangements and PTEN gene loss status should now prospectively be incorporated into a predictive model to establish whether predictive performance is improved.
20068566 TMPRSS2-ERG T1/E4 fusion-positive tumours had differentially regulated mRNAs observed in multiple studies.
20018353 When multifocal PCa demonstrates both ERG-positive and ERG-negative foci, the positive foci have a greater predilection for metastasis
19933109 study shows in prostate cancer cells, androgen signaling induces proximity of the TMPRSS2 & ERG genomic loci, located on chromosome 21q22.2; exposure to gamma irradiation, causing DNA double-strand breaks, facilitates formation of TMPRSS2-ERG gene fusion
19825963 The expression of TMPRSS2(exon 0)-ERG fusion transcripts in prostate cancer is associated with a less-aggressive biological behavior.
19716227 Our results suggest that expression of TMPRSS2-ERG is not a candidate marker to select for metastatic PCa patients who will benefit more from endocrine treatment
19664128 these findings contribute to the increasing elucidation of the role of TMPRSS2:ERG in the development of prostate cancer.
19649210 This study demonstrates that most ERG-overexpressing prostate cancers harbor hormonally regulated TMPRSS2-ERG, SLC45A3-ERG, or NDRG1-ERG fusions
19647299 Our findings demonstrate a branched DNA assay that is effective for detection of TMPRSS2-ERG gene fusion in prostate cancer clinical specimens, thus providing an alternative method to ascertain TMPRSS2-ERG gene fusion in human prostate cancer tissue
19584163 Rsults show that TMPRSS2-ERG rearrangement is common among North American men who have prostate cancer on biopsy.
19555438 Overexpression of BAALC and ERG either separate or concomitant predict adverse clinical outcome and may define important risk factor in cytogenetically normal acute myeloid leukemia
19494719 Results suggest that androgen ablation inhibits the expression of TMPRSS2:ERG, and that tumors in which pre-surgery androgen ablation fails to suppress expression of the fusion gene have a higher risk of recurrence.
19465903 TMPRSS2:ERG fusion was identified in 83% (15/18), 71% (5/7), 50% (9/18), 33% (3/9), and 29% (5/17) of mucinous, small cell, ductal, glomeruloid, and foamy gland prostate carcinomas, respectively
19407851 PTEN deletion and ERG rearrangement may cooperate, but contribute at different stages, in prostate cancer progression.
19396154 We found that TMPRSS2-ERG gene fusion is associated with the zonal origin of prostate cancer.
19359602 Antiinflammatory effects of the ETS factor ERG in endothelial cells are mediated through transcriptional repression of the interleukin-8 gene.
19339269 Multicolor fluorescence in situ hybridization shows that CRPC CTCs, metastases, and prostate tissue invariably had the same ERG gene status as therapy-naive tumors.
19223501 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
19205910 Genetic variation upstream of ERG may alter prostate cancer stage and ultimately prostate cancer-specific death but it is unlikely that it plays a role in prostate cancer development.
19205910 Observational study of gene-disease association. (HuGE Navigator)
19190343 Translocation of TMPRSS2-ERG is not associated with outcome and the aggressive clinical features associated with copy number increas in prostate cancer.
19156837 study discovered three genomic events associated with ERG rearranged prostate cancer, affecting 6q, 7q, and 16q
19151660 The presence of the TMPRSS2-ERG gene fusion in some cases of prostatic ductal adenocarcinoma supports the concept that ductal adenocarcinoma and acinar adenocarcinoma may be related genetically
19147579 study detected the TMPRSS2-ERG fusion in 44 (59%) familial prostate cancer patients; findings revealed several loci located on chromosomes #9, #18, and X that were suggestive of linkage to the TMPRSS2-ERG fusion-positive prostate cancer phenotype
19040532 EMA profiling studies on cancer of known ERG status identified a category of cancers associated with markers of poor prognosis (group II) and suggest that factors other than ERG status might be of key importance in determining a poor clinical outcome
19029822 TMPRSS2-ERG fusion is frequently observed in Gleason 3 pattern prostate cancer in a Canadian cohort.
18922926 TMPRSS2/ERG fusion isoforms have variable biological activities promoting tumor initiation and progression.
18694509 TMPRSS2-ERG gene fusion has a role in prostate cancer characteristics and outcomes
18694509 Observational study of gene-disease association. (HuGE Navigator)
18676740 analysis of the TMPRSS2-ERG splice variants in prostate cancer
18648544 IGF1 is a common target gene of Ewing's sarcoma fusion proteins EWS-FLI-1, EWS-ERG and FUS-ERG in mesenchymal progenitor cells
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18519769 The TMPRSS2:ERG rearrangement can be found in about one third of prostate cancers. A subgroup of prostate cancer patients with a good prognosis may be identified by the rearrangement.
18519767 the detection of isolated TMPRSS2-ERG fusion high-grade prostatic intraepithelial neoplasia would improve the positive predictive value of finding TMPRSS2-ERG fusion prostate cancer in subsequent biopsies.
18505969 TMPRSS2-ERG fusion prostate cancer is a distinct molecular subclass. TMPRSS2-ERG expression is regulated by a novel estrogen receptor-dependent mechanism.
18483239 TMPRSS2-ERG with interstitial deletion is an aggressive and, in this study, uniformly lethal molecular subtype of prostate cancer associated with androgen-independent disease
18474293 Detection of ETS fusion gene by RT-PCR is feasible on formalin-fixed and paraffin-embedded samples.
18195090 a new pathway regulating angiogenesis and endothelial survival, via the transcription factor Erg and the adhesion molecule VE-cadherin.
18065961 Frequent presence of the TMPRSS2-ERG in index tumors suggests critical roles of ERG alterations in the onset and progression of a large subset of prostate cancer.
17922029 Clonal ERG rearrangements were found both in high grade prostatic intraepithelial neoplasia (PIN) and in atypical in situ epithelial lesions consistent with the diagnosis of low grade PIN.
17654723 presence/absence of Alu family consensus sequence in the introns of TMPRSS2 and ERG correlates with the presence/absence of fusion transcripts and indicates consensus sequence may be involved in prostate cancer
17646667 Low expression of both ERG and BAALC identifies T-ALL patients with a distinctly favorable long-term outcome.
17632455 TMPRSS2-ERG fusion protein was found in 35/82 prostate neoplasms.
17584912 TMPRSS2:ERG prostate cancer gene fusion may lead to haploinsufficiency or additional fusion events.
17390040 findings show that the TMPRSS2-ERG fusion is common in prostate cancer and that the related TMPRSS2-ETV1 fusion is very rare; frequency of ERG-fusions in the present study is somewhat lower than previously observed
17143509 ERG overexpression and related ETS transcription factors are important for early prostate carcinogenesis.
17032499 demonstrate for the first time that the TMPRSS2-ERG fusion gene can be detected in a proportion of HGPIN lesions and that this molecular rearrangement is an early event that may precede chromosome-level alterations in prostate carcinogenesis
16954520 High expression of ERG is an adverse risk factor in adult T-ALL
16820092 genomic microdeletion of chromosome 21 is associated with rearrangement, as shown by FISH analysis of TMPRSS2/ERG fusions in prostate cancer
16575875 Data show the presence of the TMPRSS2/ERG gene fusion is common in prostate adenocarcinoma.
16303180 RT-PCR analysis of RNA isolated from bone marrow samples from the patient demonstrates that the translocation occurs within intron 1 of ERG isoform 1 and intron 2 of ELF4 resulting in an in-frame fusion joining exon 2 from ELF4 with exon 2 of ERG.
16275934 High ERG expression was associated with upregulation of 112 expressed-sequenced tags and named genes, many of which are involved in cell proliferation, differentiation, and apoptosis in acute myeloid leukemia
16215946 Patients with immunophenotype of Pre-B-acute lymphoblastic leukemia were found to carry: TLS/ERG.
16140924 It is proposed that trisomy 21 facilitates the occurrence of megakaryoblastic leukemias through a shift toward the megakaryoblastic lineage caused by the excess expression of ERG.
15988032 The oncogenic TLS-ERG fusion protein activates two different sets of genes sharing little similarity when transforms hematopoietic cells and fibroblasts.
15922298 Erg and Jun proteins interact in living cells
15068237 ERG plays a role in the development of Alzheimer's disease (AD)-like neuropathology in Down syndrome and in pathogenesis of AD per se; the manifold increase of ERG in both disorders may form a pivotal pathogenetic link.
12554743 role in regulating COL11A2 gene transcription
12449421 chemical shift and secondary structure of the PNT/SAM domains
11472898 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPAR      1 - 70
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTL     71 - 140
WSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHL    141 - 210
TSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAA    211 - 280
QPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTD    281 - 350
PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS    351 - 420
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY        421 - 486
//

Text Mined References (315)

PMID Year Title
26986253 2016 Pre-diagnostic circulating sex hormone levels and risk of prostate cancer by ERG tumour protein expression.
26978019 [Diagnostic value of estimation of ERG expression in prostate adenocarcinoma and high-grade prostatic intraepithelial neoplasia].
26743468 2016 Clonal evaluation of prostate cancer foci in biopsies with discontinuous tumor involvement by dual ERG/SPINK1 immunohistochemistry.
26690869 2016 Ewing sarcoma with ERG gene rearrangements: A molecular study focusing on the prevalence of FUS-ERG and common pitfalls in detecting EWSR1-ERG fusions by FISH.
26684029 2016 Heterogeneity and chronology of 6q15 deletion and ERG-fusion in prostate cancer.
26653555 2015 Elevated expression of microRNA-30b in osteoarthritis and its role in ERG regulation of chondrocyte.
26625814 2015 Relation of BAALC and ERG Gene Expression with Overall Survival in Acute Myeloid Leukemia Cases.
26615022 2016 A Prospective Investigation of PTEN Loss and ERG Expression in Lethal Prostate Cancer.
26554849 2016 Sequence-function correlations and dynamics of ERG isoforms. ERG8 is the black sheep of the family.
26542308 2016 Gain of chromosome 21 or amplification of chromosome arm 21q is one mechanism for increased ERG expression in acute myeloid leukemia.
26517642 2015 Prognostic relevance of proliferation markers (Ki-67, PHH3) within the cross-relation of ERG translocation and androgen receptor expression in prostate cancer.
26503111 2016 Aspirin and NSAID use in association with molecular subtypes of prostate cancer defined by TMPRSS2:ERG fusion status.
26452381 2015 Current State of ERG as Biomarker in Prostatic Adenocarcinoma.
26424596 2016 Frequency of PTEN alterations, TMPRSS2-ERG fusion and their association in prostate cancer.
26345389 2015 A molecular signature of PCA3 and ERG exosomal RNA from non-DRE urine is predictive of initial prostate biopsy result.
26344096 2015 Truncated ERG Oncoproteins from TMPRSS2-ERG Fusions Are Resistant to SPOP-Mediated Proteasome Degradation.
26344095 2015 SPOP Promotes Ubiquitination and Degradation of the ERG Oncoprotein to Suppress Prostate Cancer Progression.
26310325 2015 The transcription factor ERG increases expression of neurotransmitter receptors on prostate cancer cells.
26294063 2015 Altered PCA3 and TMPRSS2-ERG expression in histologically benign regions of cancerous prostates: a systematic, quantitative mRNA analysis in five prostates.
26261664 2015 A SMARCB1-deficient vulvar neoplasm with prominent myxoid stroma: report of a case showing ERG and FLI1 expression.
26178158 2015 PTEN loss and ERG protein expression are infrequent in prostatic ductal adenocarcinomas and concurrent acinar carcinomas.
26174629 2016 Aberrant expression of miR-9/9* in myeloid progenitors inhibits neutrophil differentiation by post-transcriptional regulation of ERG.
26172920 2015 Evaluation of ERG and SPINK1 by Immunohistochemical Staining and Clinicopathological Outcomes in a Multi-Institutional Radical Prostatectomy Cohort of 1067 Patients.
26159617 2015 Molecular basis of hERG potassium channel blockade by the class Ic antiarrhythmic flecainide.
26148230 2016 The oncofusion protein FUS-ERG targets key hematopoietic regulators and modulates the all-trans retinoic acid signaling pathway in t(16;21) acute myeloid leukemia.
26097038 2015 Articular cartilage endurance and resistance to osteoarthritic changes require transcription factor Erg.
26063314 2015 Transdifferentiation of erythroblasts to megakaryocytes using FLI1 and ERG transcription factors.
26060265 2015 ERG protein expression over time: from diagnostic biopsies to radical prostatectomy specimens in clinically localised prostate cancer.
26058078 2015 ERG Activates the YAP1 Transcriptional Program and Induces the Development of Age-Related Prostate Tumors.
26053696 2015 The predictive value of ERG protein expression for development of castration-resistant prostate cancer in hormone-naïve advanced prostate cancer treated with primary androgen deprivation therapy.
26030748 2015 Loss of SOX9 Expression Is Associated with PSA Recurrence in ERG-Positive and PTEN Deleted Prostate Cancers.
26026052 2015 The TMPRSS2-ERG Gene Fusion Blocks XRCC4-Mediated Nonhomologous End-Joining Repair and Radiosensitizes Prostate Cancer Cells to PARP Inhibition.
25977336 2015 NKX3.1 Suppresses TMPRSS2-ERG Gene Rearrangement and Mediates Repair of Androgen Receptor-Induced DNA Damage.
25972242 2015 Expression of ERG protein in prostate cancer: variability and biological correlates.
25933120 2015 Antineoplastic Effects of siRNA against TMPRSS2-ERG Junction Oncogene in Prostate Cancer.
25915839 2016 The oncogene ERG: a key factor in prostate cancer.
25899828 2015 Weaker ERG expression in patients with ERG-positive prostate cancer is associated with advanced disease and weaker androgen receptor expression: An Indian outlook.
25897494 2015 Overexpression of ERG and Wild-Type PTEN Are Associated with Favorable Clinical Prognosis and Low Biochemical Recurrence in Prostate Cancer.
25889691 2015 Analytical platform evaluation for quantification of ERG in prostate cancer using protein and mRNA detection methods.
25885538 2015 Comparison of MAPK specificity across the ETS transcription factor family identifies a high-affinity ERK interaction required for ERG function in prostate cells.
25881913 ERG is a novel and reliable marker for endothelial cells in central nervous system tumors.
25852077 2015 Obesity and Prostate Cancer Risk According to Tumor TMPRSS2:ERG Gene Fusion Status.
25754347 2015 ERG/AKR1C3/AR Constitutes a Feed-Forward Loop for AR Signaling in Prostate Cancer Cells.
25728532 2015 The TMPRSS2:ERG fusion and response to androgen deprivation therapy for prostate cancer.
25724568 2015 Heterogeneity of PTEN and ERG expression in prostate cancer on core needle biopsies: implications for cancer risk stratification and biomarker sampling.
25639219 2015 Clinical value of ERG, TFF3, and SPINK1 for molecular subtyping of prostate cancer.
25517865 2015 ERG Expression in Prostate Needle Biopsy: Potential Diagnostic and Prognostic Implications.
25479928 2015 ERG and SALL4 expressions in SMARCB1/INI1-deficient tumors: a useful tool for distinguishing epithelioid sarcoma from malignant rhabdoid tumor.
25420520 2014 ERG induces taxane resistance in castration-resistant prostate cancer.
25383866 2014 Results of a "GWAS plus:" general cognitive ability is substantially heritable and massively polygenic.
25378537 2015 ERG expression in chondrogenic bone and soft tissue tumours.
25352641 2015 The utility of ERG, CD31 and CD34 in the cytological diagnosis of angiosarcoma: an analysis of 25 cases.
25344575 2015 ERG oncoprotein inhibits ANXA2 expression and function in prostate cancer.
25306899 2015 Overexpression of ERG in cord blood progenitors promotes expansion and recapitulates molecular signatures of high ERG leukemias.
25263440 2015 TMPRSS2:ERG blocks neuroendocrine and luminal cell differentiation to maintain prostate cancer proliferation.
25239421 2014 Quantitative analysis of ERG expression and its splice isoforms in formalin-fixed, paraffin-embedded prostate cancer samples: association with seminal vesicle invasion and biochemical recurrence.
25220615 2014 ERG positive prostatic cancer may show a more angiogenetic phenotype.
25175909 2014 ERG and CHD1 heterogeneity in prostate cancer: use of confocal microscopy in assessment of microscopic foci.
25175352 2014 ERG expression in prostate cancer: the prognostic paradox.
25170998 2014 ERG monoclonal antibody in the diagnosis and biological stratification of prostate cancer: delineation of minimal epitope, critical residues for binding, and molecular basis of specificity.
25062690 2014 ERG-APLNR axis controls pulmonary venule endothelial proliferation in pulmonary veno-occlusive disease.
25043536 2014 KLK3, PCA3, and TMPRSS2-ERG expression in the peripheral blood mononuclear cell fraction from castration-resistant prostate cancer patients and response to docetaxel treatment.
25043157 2014 Frequent discordance between ERG gene rearrangement and ERG protein expression in a rapid autopsy cohort of patients with lethal, metastatic, castration-resistant prostate cancer.
25015038 2014 TMPRSS2-ERG fusions are strongly linked to young patient age in low-grade prostate cancer.
25007891 2014 The role of TMPRSS2:ERG in molecular stratification of PCa and its association with tumor aggressiveness: a study in Brazilian patients.
24997128 2015 TMPRSS2-ERG fusion transcripts expression in patients referred for prostate biopsy: combining detection in urine and needle rinse material.
24972028 2014 The prognostic significance of combined ERG and androgen receptor expression in patients with prostate cancer managed by androgen deprivation therapy.
24961351 2014 Detection of TMPRSS2-ERG fusion gene in benign prostatic hyperplasia.
24931216 2014 In situ sequencing identifies TMPRSS2-ERG fusion transcripts, somatic point mutations and gene expression levels in prostate cancers.
24926821 2014 The prostate cancer TMPRSS2:ERG fusion synergizes with the vitamin D receptor (VDR) to induce CYP24A1 expression-limiting VDR signaling.
24925673 2014 Androgen receptor CAG repeat polymorphism and risk of TMPRSS2:ERG-positive prostate cancer.
24909781 2014 Increased association of the ERG oncoprotein expression in advanced stages of prostate cancer in Filipinos.
24796295 2014 ERG expression is associated with increased risk of biochemical relapse following radical prostatectomy in early onset prostate cancer.
24789172 2014 NY-ESO-1 expression is tightly linked to TMPRSS2-ERG fusion in prostate cancer.
24777847 2015 Increased androgen receptor gene copy number is associated with TMPRSS2-ERG rearrangement in prostatic small cell carcinoma.
24762546 2014 Heterogeneity and chronology of PTEN deletion and ERG fusion in prostate cancer.
24707153 2014 Transcription factor ERG is a specific and sensitive diagnostic marker for hepatic angiosarcoma.
24705308 2014 Utility of ERG versus AMACR expression in diagnosis of minimal adenocarcinoma of the prostate in needle biopsy tissue.
24504051 2014 ERG induces a mesenchymal-like state associated with chemoresistance in leukemia cells.
24469092 2014 ERG rearrangement and protein expression in the progression to castration-resistant prostate cancer.
24435928 2014 ERG-SOX4 interaction promotes epithelial-mesenchymal transition in prostate cancer cells.
24418414 2014 Loss of the NKX3.1 tumorsuppressor promotes the TMPRSS2-ERG fusion gene expression in prostate cancer.
24406865 2014 ERG expression in intraductal carcinoma of the prostate: comparison with adjacent invasive prostatic adenocarcinoma.
24380696 2014 High RNA-binding motif protein 3 expression is an independent prognostic marker in operated prostate cancer and tightly linked to ERG activation and PTEN deletions.
24334129 2014 The variant hERG/R148W associated with LQTS is a mutation that reduces current density on co-expression with the WT.
24306662 2014 DNA methylation profiling identifies EYA4 gene as a prognostic molecular marker in hepatocellular carcinoma.
24297949 2014 TMPRSS2:ERG gene fusion predicts subsequent detection of prostate cancer in patients with high-grade prostatic intraepithelial neoplasia.
24292212 2013 Modification of the association between obesity and lethal prostate cancer by TMPRSS2:ERG.
24195515 2014 Relation of ETS transcription factor family member ERG, androgen receptor and topoisomerase 2? expression to TMPRSS2-ERG fusion status in prostate cancer.
24186205 2014 TMPRSS2-ERG gene fusions induce prostate tumorigenesis by modulating microRNA miR-200c.
24115221 2014 Evaluation of ERG responsive proteome in prostate cancer.
24072184 2014 Evaluation of tissue PCA3 expression in prostate cancer by RNA in situ hybridization--a correlative study with urine PCA3 and TMPRSS2-ERG.
24072183 2014 ERG and FLI1 protein expression in epithelioid sarcoma.
24072102 2014 ERG deletion is associated with CD2 and attenuates the negative impact of IKZF1 deletion in childhood acute lymphoblastic leukemia.
24064621 2014 An intragenic ERG deletion is a marker of an oncogenic subtype of B-cell precursor acute lymphoblastic leukemia with a favorable outcome despite frequent IKZF1 deletions.
24006850 2014 Interrogation of ERG gene rearrangements in prostate cancer identifies a prognostic 10-gene signature with relevant implication to patients' clinical outcome.
23974202 2013 Genome-scale expression and transcription factor binding profiles reveal therapeutic targets in transgenic ERG myeloid leukemia.
23918819 2013 Transcriptional regulation of CXCR4 in prostate cancer: significance of TMPRSS2-ERG fusions.
23913826 2013 ERG is a critical regulator of Wnt/LEF1 signaling in prostate cancer.
23898196 2013 Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
23887154 2013 Atypical adenomatous hyperplasia of prostate lacks TMPRSS2-ERG gene fusion.
23856515 2013 V-ets erythroblastosis virus E26 oncogene homolog (avian)/Trefoil factor 3/high-molecular-weight cytokeratin triple immunostain: a novel tissue-based biomarker in prostate cancer with potential clinical application.
23850495 2013 Frequent TMPRSS2-ERG rearrangement in prostatic small cell carcinoma detected by fluorescence in situ hybridization: the superiority of fluorescence in situ hybridization over ERG immunohistochemistry.
23849895 2013 ERG expression in mucinous prostatic adenocarcinoma and prostatic adenocarcinoma with mucinous features: comparison with conventional prostatic adenocarcinoma.
23817021 2013 ETS factors reprogram the androgen receptor cistrome and prime prostate tumorigenesis in response to PTEN loss.
23797726 2013 Foamy gland carcinoma of the prostate in needle biopsy: incidence, Gleason grade, and comparative ?-methylacyl-CoA racemase vs. ERG expression.
23794398 2013 Recurrent deletion of 3p13 targets multiple tumour suppressor genes and defines a distinct subgroup of aggressive ERG fusion-positive prostate cancers.
23781502 2013 Molecular characterization and clinical impact of TMPRSS2-ERG rearrangement on prostate cancer: comparison between FISH and RT-PCR.
23774169 2013 ERG expression in epithelioid sarcoma: a diagnostic pitfall.
23728339 2014 miR-30 as a tumor suppressor connects EGF/Src signal to ERG and EMT.
23703293 2013 ERG expression and prostatic adenocarcinoma.
23701505 2013 TMPRSS2-ERG rearrangement in dominant anterior prostatic tumours: incidence and correlation with ERG immunohistochemistry.
23686669 2013 Prognostic potential of ERG (ETS-related gene) expression in prostatic adenocarcinoma.
23653096 2013 ERG overexpression and PTEN status predict capsular penetration in prostate carcinoma.
23642739 2013 Overexpression of the chromatin remodeler death-domain-associated protein in prostate cancer is an independent predictor of early prostate-specific antigen recurrence.
23578236 2013 High-resolution ERG-expression profiling on GeneChip exon 1.0 ST arrays in primary and castration-resistant prostate cancer.
23555854 2013 ERG induces epigenetic activation of Tudor domain-containing protein 1 (TDRD1) in ERG rearrangement-positive prostate cancer.
23554889 2013 Celastrol suppresses tumor cell growth through targeting an AR-ERG-NF-?B pathway in TMPRSS2/ERG fusion gene expressing prostate cancer.
23546179 2014 Identification and characterization of a novel genetic mutation with prolonged QT syndrome in an unexplained postoperative death.
23545904 2013 Assessing the order of critical alterations in prostate cancer development and progression by IHC: further evidence that PTEN loss occurs subsequent to ERG gene fusion.
23535644 2013 Monoallelic expression of TMPRSS2/ERG in prostate cancer stem cells.
23480797 2013 The proto-oncogene ERG is a target of microRNA miR-145 in prostate cancer.
23472063 2013 5' UTR control of native ERG and of Tmprss2:ERG variants activity in prostate cancer.
23462600 2013 Immunohistochemical evaluation of ERG expression in various benign and malignant tissues.
23459095 2013 A high-density tissue microarray from patients with clinically localized prostate cancer reveals ERG and TATI exclusivity in tumor cells.
23447416 2013 Nucleotide resolution analysis of TMPRSS2 and ERG rearrangements in prostate cancer.
23426182 2013 ERG induces androgen receptor-mediated regulation of SOX9 in prostate cancer.
23390522 2013 Characterization of transcriptional changes in ERG rearrangement-positive prostate cancer identifies the regulation of metabolic sensors such as neuropeptide Y.
23381693 2013 Distinct ERG rearrangement prevalence in prostate cancer: higher frequency in young age and in low PSA prostate cancer.
23380710 2013 AKT collaborates with ERG and Gata1s to dysregulate megakaryopoiesis and promote AMKL.
23352841 A novel four-color fluorescence in situ hybridization assay for the detection of TMPRSS2 and ERG rearrangements in prostate cancer.
23348902 2013 Novel dual-color immunohistochemical methods for detecting ERG-PTEN and ERG-SPINK1 status in prostate carcinoma.
23334893 2013 Prognostic value of ERG oncoprotein in prostate cancer recurrence and cause-specific mortality.
23327922 2013 Activity of a heptad of transcription factors is associated with stem cell programs and clinical outcome in acute myeloid leukemia.
23319146 2013 Identification of TDRD1 as a direct target gene of ERG in primary prostate cancer.
23319000 2014 Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid.
23300998 2013 ERG transcriptional networks in primary acute leukemia cells implicate a role for ERG in deregulated kinase signaling.
23250622 2013 High expression of the Ets-related gene (ERG) is an independent prognostic marker for relapse-free survival in patients with acute promyelocytic leukemia.
23158212 2013 The diagnostic use of ERG in resolving an "atypical glands suspicious for cancer" diagnosis in prostate biopsies beyond that provided by basal cell and ?-methylacyl-CoA-racemase markers.
23027626 2012 Integrin-linked kinase as a target for ERG-mediated invasive properties in prostate cancer models.
22993300 2012 Whole-transcriptome analysis reveals established and novel associations with TMPRSS2:ERG fusion in prostate cancer.
22930729 2012 Genome-wide DNA methylation events in TMPRSS2-ERG fusion-negative prostate cancers implicate an EZH2-dependent mechanism with miR-26a hypermethylation.
22922762 2012 ERG is specifically associated with ETS-2 and ETV-4, but not with ETS-1, in prostate cancer.
22899295 2013 Marked heterogeneity of ERG expression in large primary prostate cancers.
22886792 2013 Loss of pSer2448-mTOR expression is linked to adverse prognosis and tumor progression in ERG-fusion-positive cancers.
22869147 2013 Erg and AP-1 as determinants of glucocorticoid response in acute lymphoblastic leukemia.
22860005 2012 TMPRSS2- driven ERG expression in vivo increases self-renewal and maintains expression in a castration resistant subpopulation.
22821757 2013 Loss of SLC45A3 protein (prostein) expression in prostate cancer is associated with SLC45A3-ERG gene rearrangement and an unfavorable clinical course.
22767266 2012 ERG rearrangement in local recurrences compared to distant metastases of castration-resistant prostate cancer.
22745159 2012 Modulation of hERG potassium channel gating normalizes action potential duration prolonged by dysfunctional KCNQ1 potassium channel.
22736790 2012 The TMPRSS2:ERG rearrangement, ERG expression, and prostate cancer outcomes: a cohort study and meta-analysis.
22716285 2012 Expression of ERG, an Ets family transcription factor, distinguishes cutaneous angiosarcoma from histological mimics.
22705054 2012 Genomic deletion of PTEN is associated with tumor progression and early PSA recurrence in ERG fusion-positive and fusion-negative prostate cancer.
22696228 2012 ERG rearrangement for predicting subsequent cancer diagnosis in high-grade prostatic intraepithelial neoplasia and lymph node metastasis.
22674214 2013 Rational basis for the combination of PCA3 and TMPRSS2:ERG gene fusion for prostate cancer diagnosis.
22615383 2012 Oncogene-mediated alterations in chromatin conformation.
22531786 2012 A transcriptional repressor co-regulatory network governing androgen response in prostate cancers.
22505341 2012 Combined analysis of TMPRSS2-ERG and TERT for improved prognosis of biochemical recurrence in prostate cancer.
22488406 2012 Prognostic significance of combined MN1, ERG, BAALC, and EVI1 (MEBE) expression in patients with myelodysplastic syndromes.
22463702 2012 High level of Ets-related gene expression has high specificity for prostate cancer: a tissue microarray study of 11 483 cancers.
22337883 2012 The transcription factor Erg controls endothelial cell quiescence by repressing activity of nuclear factor (NF)-?B p65.
22331093 2012 Clinical potential of the ERG oncoprotein in prostate cancer.
22313860 2012 Phase II study of cytarabine in men with docetaxel-refractory, castration-resistant prostate cancer with evaluation of TMPRSS2-ERG and SPINK1 as serum biomarkers.
22300588 2012 ERG protein expression reflects hormonal treatment response and is associated with Gleason score and prostate cancer specific mortality.
22245323 2012 Molecular diagnosis of prostate cancer: PCA3 and TMPRSS2:ERG gene fusion.
22235125 2012 ETS-related gene (ERG) controls endothelial cell permeability via transcriptional regulation of the claudin 5 (CLDN5) gene.
22221250 2012 Amplified segment in the 'Down syndrome critical region' on HSA21 shared between Down syndrome and euploid AML-M0 excludes RUNX1, ERG and ETS2.
22080055 2012 ERG immunohistochemistry is not predictive for PSA recurrence, local recurrence or overall survival after radical prostatectomy for prostate cancer.
22076164 2011 The oncogenic gene fusion TMPRSS2: ERG is not a diagnostic or prognostic marker for ovarian cancer.
21946329 2011 A DNA methylation microarray-based study identifies ERG as a gene commonly methylated in prostate cancer.
21937078 2012 The relationship of TMPRSS2-ERG gene fusion between primary and metastatic prostate cancers.
21835957 2011 Pediatric-inspired intensified therapy of adult T-ALL reveals the favorable outcome of NOTCH1/FBXW7 mutations, but not of low ERG/BAALC expression: a GRAALL study.
21802835 2011 TMPRSS2-ERG status in circulating tumor cells as a predictive biomarker of sensitivity in castration-resistant prostate cancer patients treated with abiraterone acetate.
21791629 2011 ERG status is unrelated to PSA recurrence in radically operated prostate cancer in the absence of antihormonal therapy.
21743959 2011 Analysis of laser-microdissected prostate cancer tissues reveals potential tumor markers.
21743434 2011 Increased gene copy number of ERG on chromosome 21 but not TMPRSS2-ERG fusion predicts outcome in prostatic adenocarcinomas.
21738478 2011 Identification of nine novel loci associated with white blood cell subtypes in a Japanese population.
21731703 2011 Role of TMPRSS2-ERG gene fusion in negative regulation of PSMA expression.
21707844 2011 Immunohistochemical ETS-related gene detection in a Japanese prostate cancer cohort: diagnostic use in Japanese prostate cancer patients.
21680704 2011 Inactivation of AR/TMPRSS2-ERG/Wnt signaling networks attenuates the aggressive behavior of prostate cancer cells.
21677539 2011 Immunohistochemistry for ERG expression as a surrogate for TMPRSS2-ERG fusion detection in prostatic adenocarcinomas.
21676887 2011 TMPRSS2-ERG-mediated feed-forward regulation of wild-type ERG in human prostate cancers.
21669963 2011 Abnormal expression of the ERG transcription factor in prostate cancer cells activates osteopontin.
21664289 2011 Acute myeloid leukemia: a central role for the ETS factor ERG.
21623182 2011 The utility of ERG/P63 double immunohistochemical staining in the diagnosis of limited cancer in prostate needle biopsies.
21600800 2013 Combining urinary detection of TMPRSS2:ERG and PCA3 with serum PSA to predict diagnosis of prostate cancer.
21584900 2011 Relative 8q gain predicts disease-specific survival irrespective of the TMPRSS2-ERG fusion status in diagnostic biopsies of prostate cancer.
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21559405 2011 YK-4-279 inhibits ERG and ETV1 mediated prostate cancer cell invasion.
21536859 2011 ERG promotes T-acute lymphoblastic leukemia and is transcriptionally regulated in leukemic cells by a stem cell enhancer.
21499238 2011 ERG-TMPRSS2 rearrangement is shared by concurrent prostatic adenocarcinoma and prostatic small cell carcinoma and absent in small cell carcinoma of the urinary bladder: evidence supporting monoclonal origin.
21474234 2011 Confirmation of the association of TMPRSS2(exon 0):ERG expression and a favorable prognosis of primary prostate cancer.
21394739 2011 TMPRSS2/ERG fusion gene expression alters chemo- and radio-responsiveness in cell culture models of androgen independent prostate cancer.
21383613 2011 The diagnostic utility of novel immunohistochemical marker ERG in the workup of prostate biopsies with "atypical glands suspicious for cancer".
21317715 2011 ERG transcription factor as an immunohistochemical marker for vascular endothelial tumors and prostatic carcinoma.
21249148 2011 The N-terminal tail of hERG contains an amphipathic ?-helix that regulates channel deactivation.
21242973 2011 Genome-wide screen reveals WNT11, a non-canonical WNT gene, as a direct target of ETS transcription factor ERG.
21178509 2011 Detection of ERG gene rearrangements and PTEN deletions in unsuspected prostate cancer of the transition zone.
21170267 2010 ERG cooperates with androgen receptor in regulating trefoil factor 3 in prostate cancer disease progression.
21169414 2011 Activation of NF-{kappa}B by TMPRSS2/ERG Fusion Isoforms through Toll-Like Receptor-4.
21167530 2011 Single focus prostate cancer: pathological features and ERG fusion status.
21062978 2010 The ability of biomarkers to predict systemic progression in men with high-risk prostate cancer treated surgically is dependent on ERG status.
21040948 2011 TMPRSS2-ERG gene fusion in small cell carcinoma of the prostate.
20966395 2011 The transcription factor Erg inhibits vascular inflammation by repressing NF-kappaB activation and proinflammatory gene expression in endothelial cells.
20860828 2010 Changes in cortical cytoskeletal and extracellular matrix gene expression in prostate cancer are related to oncogenic ERG deregulation.
20841507 2010 BAALC and ERG expression levels are associated with outcome and distinct gene and microRNA expression profiles in older patients with de novo cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.
20800881 2010 TMPRSS2-ERG gene fusion and clinicopathologic characteristics of Korean prostate cancer patients.
20798944 2010 [Dangerous liaisons in prostate cancer. Clinical and biological implications of recurrent gene fusions].
20713528 2010 FZD4 as a mediator of ERG oncogene-induced WNT signaling and epithelial-to-mesenchymal transition in human prostate cancer cells.
20693982 2010 ERG rearrangement is present in a subset of transition zone prostatic tumors.
20676125 2010 A previously unrecognized promoter of LMO2 forms part of a transcriptional regulatory circuit mediating LMO2 expression in a subset of T-acute lymphoblastic leukaemia patients.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
20651988 2010 Antibody-based detection of ERG rearrangement-positive prostate cancer.
20590547 2011 PTEN genomic deletion is an early event associated with ERG gene rearrangements in prostate cancer.
20585344 2010 ERG oncoprotein expression in prostate cancer: clonal progression of ERG-positive tumor cells and potential for ERG-based stratification.
20570349 2011 The role of microRNA-196a and microRNA-196b as ERG regulators in acute myeloid leukemia and acute T-lymphoblastic leukemia.
20562851 2010 TMPRSS2-ERG gene fusion is associated with low Gleason scores and not with high-grade morphological features.
20546020 2010 ETS-related gene ERG expression in AML patients is significantly associated with NPM1 mutation status.
20526358 2010 Fluorescence-tracking of activation gating in human ERG channels reveals rapid S4 movement and slow pore opening.
20478527 2010 An integrated network of androgen receptor, polycomb, and TMPRSS2-ERG gene fusions in prostate cancer progression.
20473283 2010 ERG rearrangement is specific to prostate cancer and does not occur in any other common tumor.
20442300 2010 Association of SPINK1 expression and TMPRSS2:ERG fusion with prognosis in endocrine-treated prostate cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20308673 2010 Impact of EWS-ETS fusion type on disease progression in Ewing's sarcoma/peripheral primitive neuroectodermal tumor: prospective results from the cooperative Euro-E.W.I.N.G. 99 trial.
20308669 2010 Current treatment protocols have eliminated the prognostic advantage of type 1 fusions in Ewing sarcoma: a report from the Children's Oncology Group.
20303538 2010 Clinical implications of TMPRSS2-ERG gene fusion expression in patients with prostate cancer treated with radical prostatectomy.
20160063 2010 Evaluation of the ETS-related gene mRNA in urine for the detection of prostate cancer.
20118910 2010 Prevalence of TMPRSS2-ERG and SLC45A3-ERG gene fusions in a large prostatectomy cohort.
20104229 2010 Molecular characterisation of ERG, ETV1 and PTEN gene loci identifies patients at low and high risk of death from prostate cancer.
20068566 2010 Prostate cancer genes associated with TMPRSS2-ERG gene fusion and prognostic of biochemical recurrence in multiple cohorts.
20018353 2010 ERG rearrangement metastasis patterns in locally advanced prostate cancer.
19933109 2009 Induced chromosomal proximity and gene fusions in prostate cancer.
19825963 2009 Overexpression of prostate-specific TMPRSS2(exon 0)-ERG fusion transcripts corresponds with favorable prognosis of prostate cancer.
19716227 2010 Expression of the androgen-regulated fusion gene TMPRSS2-ERG does not predict response to endocrine treatment in hormone-naïve, node-positive prostate cancer.
19664128 2009 TMPRSS2:ERG fusion transcripts in urine from prostate cancer patients correlate with a less favorable prognosis.
19649210 2009 N-myc downstream regulated gene 1 (NDRG1) is fused to ERG in prostate cancer.
19647299 2009 Detection of TMPRSS2-ERG fusion gene expression in prostate cancer specimens by a novel assay using branched DNA.
19584163 2009 Prevalence of TMPRSS2-ERG fusion prostate cancer among men undergoing prostate biopsy in the United States.
19555438 2010 BAALC and ERG expression in acute myeloid leukemia with normal karyotype: impact on prognosis.
19494719 2009 Persistence of expression of the TMPRSS2:ERG fusion gene after pre-surgery androgen ablation may be associated with early prostate specific antigen relapse of prostate cancer: preliminary results.
19465903 2009 Characterization of ETS gene aberrations in select histologic variants of prostate carcinoma.
19407851 2009 Fluorescence in situ hybridization study shows association of PTEN deletion with ERG rearrangement during prostate cancer progression.
19396154 2009 Prostate cancer of transition zone origin lacks TMPRSS2-ERG gene fusion.
19359602 2009 Antiinflammatory effects of the ETS factor ERG in endothelial cells are mediated through transcriptional repression of the interleukin-8 gene.
19339269 2009 Characterization of ERG, AR and PTEN gene status in circulating tumor cells from patients with castration-resistant prostate cancer.
19223501 2009 Utility of incorporating genetic variants for the early detection of prostate cancer.
19205910 2009 Genetic variation in the upstream region of ERG and prostate cancer.
19190343 2009 TMPRSS2-ERG gene fusion is not associated with outcome in patients treated by prostatectomy.
19156837 2009 Distinct genomic aberrations associated with ERG rearranged prostate cancer.
19151660 2009 TMPRSS2-ERG gene fusions are infrequent in prostatic ductal adenocarcinomas.
19147579 2009 Genome-wide linkage analysis of TMPRSS2-ERG fusion in familial prostate cancer.
19040532 2009 Integration of ERG gene mapping and gene-expression profiling identifies distinct categories of human prostate cancer.
19029822 2009 TMPRSS2-ERG fusion is frequently observed in Gleason pattern 3 prostate cancer in a Canadian cohort.
18922926 2008 Pleiotropic biological activities of alternatively spliced TMPRSS2/ERG fusion gene transcripts.
18694509 2008 Association of TMPRSS2-ERG gene fusion with clinical characteristics and outcomes: results from a population-based study of prostate cancer.
18676740 2008 Delineation of TMPRSS2-ERG splice variants in prostate cancer.
18648544 2008 IGF1 is a common target gene of Ewing's sarcoma fusion proteins in mesenchymal progenitor cells.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18519769 2008 TMPRSS2:ERG fusion identifies a subgroup of prostate cancers with a favorable prognosis.
18519767 2008 Characterization of TMPRSS2-ERG fusion high-grade prostatic intraepithelial neoplasia and potential clinical implications.
18505969 2008 Estrogen-dependent signaling in a molecularly distinct subclass of aggressive prostate cancer.
18483239 2008 Characterization of TMPRSS2-ETS gene aberrations in androgen-independent metastatic prostate cancer.
18474293 2008 Detection of the TMPRSS2-ETS fusion gene in prostate carcinomas: retrospective analysis of 55 formalin-fixed and paraffin-embedded samples with clinical data.
18195090 2008 Transcription factor Erg regulates angiogenesis and endothelial apoptosis through VE-cadherin.
18065961 2008 Mapping of TMPRSS2-ERG fusions in the context of multi-focal prostate cancer.
17922029 2008 Complex patterns of ETS gene alteration arise during cancer development in the human prostate.
17654723 2007 Multiple genomic alterations on 21q22 predict various TMPRSS2/ERG fusion transcripts in human prostate cancers.
17646667 2007 Low ERG and BAALC expression identifies a new subgroup of adult acute T-lymphoblastic leukemia with a highly favorable outcome.
17632455 2007 Gene fusions between TMPRSS2 and ETS family genes in prostate cancer: frequency and transcript variant analysis by RT-PCR and FISH on paraffin-embedded tissues.
17584912 2007 Microdeletion and concurrent translocation associated with a complex TMPRSS2:ERG prostate cancer gene fusion.
17390040 2007 Molecular genetic analyses of the TMPRSS2-ERG and TMPRSS2-ETV1 gene fusions in 50 cases of prostate cancer.
17289661 2007 Molecular composition of IMP1 ribonucleoprotein granules.
17143509 2007 ERG upregulation and related ETS transcription factors in prostate cancer.
17032499 2006 TMPRSS2-ERG gene fusion causing ERG overexpression precedes chromosome copy number changes in prostate carcinomas and paired HGPIN lesions.
16954520 2006 High expression of the ETS transcription factor ERG predicts adverse outcome in acute T-lymphoblastic leukemia in adults.
16820092 2006 Three-color FISH analysis of TMPRSS2/ERG fusions in prostate cancer indicates that genomic microdeletion of chromosome 21 is associated with rearrangement.
16575875 2006 Confirmation of the high frequency of the TMPRSS2/ERG fusion gene in prostate cancer.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303180 2006 ELF4 is fused to ERG in a case of acute myeloid leukemia with a t(X;21)(q25-26;q22).
16275934 2005 Overexpression of the ETS-related gene, ERG, predicts a worse outcome in acute myeloid leukemia with normal karyotype: a Cancer and Leukemia Group B study.
16254181 2005 Recurrent fusion of TMPRSS2 and ETS transcription factor genes in prostate cancer.
16215946 2005 [Detection of fusion genes resulting from chromosome abnormalities in childhood acute lymphoblastic leukemia].
16140924 2005 The proto-oncogene ERG in megakaryoblastic leukemias.
15988032 2005 The oncogenic TLS-ERG fusion protein exerts different effects in hematopoietic cells and fibroblasts.
15922298 2005 Imaging Erg and Jun transcription factor interaction in living cells using fluorescence resonance energy transfer analyses.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15351649 2004 Diversity in structure and function of the Ets family PNT domains.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15068237 2003 Aberrant protein expression of transcription factors BACH1 and ERG, both encoded on chromosome 21, in brains of patients with Down syndrome and Alzheimer's disease.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14693372 2004 Detailed mapping of the ERG-ETS2 interval of human chromosome 21 and comparison with the region of conserved synteny on mouse chromosome 16.
12554743 2003 COL11A2 collagen gene transcription is differentially regulated by EWS/ERG sarcoma fusion protein and wild-type ERG.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12449421 2002 Chemical shift and secondary structure conservation of the PNT/SAM domains from the ets family of transcription factors.
11791185 2002 Molecular cloning of ESET, a novel histone H3-specific methyltransferase that interacts with ERG transcription factor.
11472898 2001 Estrogen receptor gene polymorphism and bone mineral density in postmenopausal Chinese women.
11278640 2001 Identification of amino acid residues in the ETS transcription factor Erg that mediate Erg-Jun/Fos-DNA ternary complex formation.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10949935 2000 A novel zinc finger gene is fused to EWS in small round cell tumor.
10830953 2000 The DNA sequence of human chromosome 21.
10574717 1999 Characterisation of the tumour necrosis factor (TNF)-(alpha) response elements in the human ICAM-2 promoter.
9681824 1998 Erg proteins, transcription factors of the Ets family, form homo, heterodimers and ternary complexes via two distinct domains.
9334186 1997 The Ets transcription factors interact with each other and with the c-Fos/c-Jun complex via distinct protein domains in a DNA-dependent and -independent manner.
8510931 1993 New human erg isoforms generated by alternative splicing are transcriptional activators.
8502479 1993 Human ERG-2 protein is a phosphorylated DNA-binding protein--a distinct member of the ets family.
8290279 1994 Differentially spliced erg-3 product functions as a transcriptional activator.
8187069 1994 An RNA-binding protein gene, TLS/FUS, is fused to ERG in human myeloid leukemia with t(16;21) chromosomal translocation.
8076344 1994 ERG gene is translocated in an Ewing's sarcoma cell line.
8040301 1994 EWS-erg and EWS-Fli1 fusion transcripts in Ewing's sarcoma and primitive neuroectodermal tumors with variant translocations.
7849696 1994 A transcript map of the Down syndrome critical region on chromosome 21.
3476934 1987 The erg gene: a human gene related to the ets oncogene.
3299708 1987 erg, a human ets-related gene on chromosome 21: alternative splicing, polyadenylation, and translation.
3274086 1988 The human erg gene maps to chromosome 21, band q22: relationship to the 8; 21 translocation of acute myelogenous leukemia.