Property Summary

Ligand Count 1
NCBI Gene PubMed Count 363
PubMed Score 12.31
PubTator Score 2054.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Expression

  Differential Expression (17)

Disease log2 FC p
Breast cancer 1.500 1.2e-02
breast carcinoma -1.500 9.4e-07
cystic fibrosis -2.744 1.9e-07
ductal carcinoma in situ -1.300 7.9e-04
gastric carcinoma 1.100 4.2e-02
interstitial cystitis 1.600 2.2e-05
intraductal papillary-mucinous adenoma (... -1.100 1.4e-04
intraductal papillary-mucinous carcinoma... -1.800 1.3e-02
intraductal papillary-mucinous neoplasm ... -2.100 3.2e-02
invasive ductal carcinoma -2.100 4.5e-04
lung adenocarcinoma -1.600 7.0e-18
lung cancer -2.100 1.2e-03
lung carcinoma -2.000 5.8e-12
nephrosclerosis 1.042 4.8e-04
non-small cell lung cancer -1.064 4.2e-21
osteosarcoma -2.402 6.4e-06
ovarian cancer -1.100 3.9e-04

Gene RIF (331)

AA Sequence

MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPAR      1 - 70
VTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTL     71 - 140
WSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHL    141 - 210
TSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAA    211 - 280
QPSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTD    281 - 350
PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS    351 - 420
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY        421 - 486
//

Text Mined References (367)

PMID Year Title