Property Summary

NCBI Gene PubMed Count 10
PubMed Score 40.66
PubTator Score 9.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
invasive ductal carcinoma 3.000 3.2e-02
ovarian cancer 4.000 5.6e-03
pancreatic cancer 2.000 6.4e-03

Gene RIF (6)

AA Sequence

MKTLAGLVLGLVIFDAAVTAPTLESINYDSETYDATLEDLDNLYNYENIPVDKVEIEIATVMPSGNRELL      1 - 70
TPPPQPEKAQEEEEEEESTPRLIDGSSPQEPEFTGVLGPHTNEDFPTCLLCTCISTTVYCDDHELDAIPP     71 - 140
LPKNTAYFYSRFNRIKKINKNDFASLSDLKRIDLTSNLISEIDEDAFRKLPQLRELVLRDNKIRQLPELP    141 - 210
TTLTFIDISNNRLGRKGIKQEAFKDMYDLHHLYLTDNNLDHIPLPLPENLRALHLQNNNILEMHEDTFCN    211 - 280
VKNLTYIRKALEDIRLDGNPINLSKTPQAYMCLPRLPVGSLV                                281 - 322
//

Text Mined References (11)

PMID Year Title