Property Summary

NCBI Gene PubMed Count 31
PubMed Score 524.62
PubTator Score 345.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.767 9.7e-10

Gene RIF (20)

PMID Text
26386352 Myeloperoxidase and eosinophil peroxidase are readily internalized by HUVEC cells where they promote cellular proliferation, migration, invasion, and stimulate angiogenesis both in vitro and in vivo.
24937179 A preferential role of EPO signaling via a specific surface receptor that leads to neural plasticity.
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
24738159 report the prevalence of a common SNP in the eosinophil protein x/eosinophil-derived neurotoxin (EPX/EDN, RNase2) and the association with the cellular contents of EPX/EDN and ECP
23931643 Eosinophil peroxidase in sputum represents a unique biomarker of airway eosinophilia.
23197886 Polymorphisms of EPX and ECP are associated to inflammatory bowel disease in an age and gender dependent manne.
22750539 Data indicate that eosinophil peroxidase (EPX)-based ELISA is the only eosinophil-specific assay.
22702502 A mechanism of induction of ASIC-3 expression relevant to AR was suggested by the finding that eosinophil peroxidase (EPO), acting via ERK1/2, induced the expression of ASIC-3 in epithelial cells.
21454806 HER2 was identified as a novel mediator of eosinophil peroxidase signaling. Eosinophil peroxidase, at noncytotoxic levels, can drive cell-cycle progression and proliferation.
20501663 EPO-dependent oxidative damage may play a role in tissue injury in bisulfite-exacerbated eosinophilic inflammatory disorders
20453000 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19439985 Genetic variability in the EPO gene may contribute to the susceptibility to allergic rhinitis (or related phenotypes) in the Czech population.
19014520 No variation in genes eosinophil peroxidase for Atopic dermatitis pathogenesis in this German cohort.
18694936 post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase
16336215 The mechanisms by which eosinophil peroxidase oxidizes nitrite are reported.
15894800 Analysis of the role of thiocyanate (SCN-), in modulating the catalytic activity of myeloperoxidase (MPO) and other members of the lactoperoxidase (LPO) and eosinophil peroxidase (EPO)
15316147 Polymorphisms of the eosinophil peroxidase gene may be associated with Japanese cedar pollinosis.
14657871 results suggest that Pro358Leu in EPO is strongly involved in the development of cedar pollinosis
12540536 induces surface alteration, killing, and lysis of Mycobacterium tuberculosis

AA Sequence

MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPM      1 - 70
DLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTEPQLRLLSQASGCALRDQAER     71 - 140
CSDKYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPLVRAVSNQIVRFP    141 - 210
NERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRD    211 - 280
CIPFFRSAPSCPQNKNRVRNQINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLP    281 - 350
FDNLHDDPCLLTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARK    351 - 420
IMGAMVQIITYRDFLPLVLGKARARRTLGHYRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRA    421 - 490
SAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNM    491 - 560
QRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLARKFLNLYGTPDNIDIWIGAIAEPLLPGARVG    561 - 630
PLLACLFENQFRRARDGDRFWWQKRGVFTKRQRKALSRISLSRIICDNTGITTVSRDIFRANIYPRGFVN    631 - 700
CSRIPRLNLSAWRGT                                                           701 - 715
//

Text Mined References (31)

PMID Year Title
26386352 2015 Uncovering a new role for peroxidase enzymes as drivers of angiogenesis.
24937179 2014 Eosinophil peroxidase induces expression of cholinergic genes via cell surface neural interactions.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24738159 2014 The production of the eosinophil proteins ECP and EPX/EDN are regulated in a reciprocal manner.
23931643 2013 Eosinophil peroxidase in sputum represents a unique biomarker of airway eosinophilia.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23197886 2012 Eosinophil associated genes in the inflammatory bowel disease 4 region: correlation to inflammatory bowel disease revealed.
22750539 2012 A sensitive high throughput ELISA for human eosinophil peroxidase: a specific assay to quantify eosinophil degranulation from patient-derived sources.
22702502 2012 Eosinophil peroxidase induces the expression and function of acid-sensing ion channel-3 in allergic rhinitis: in vitro evidence in cultured epithelial cells.
21454806 2011 Eosinophil peroxidase signals via epidermal growth factor-2 to induce cell proliferation.
20501663 2010 Protein Radical Formation Resulting from Eosinophil Peroxidase-catalyzed Oxidation of Sulfite.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19439985 2009 Association of single nucleotide polymorphisms in the eosinophil peroxidase gene with allergic rhinitis in the Czech population.
19014520 2008 Variation in genes encoding eosinophil granule proteins in atopic dermatitis patients from Germany.
18694936 2008 Post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16336215 2006 Mechanism of nitrite oxidation by eosinophil peroxidase: implications for oxidant production and nitration by eosinophils.
15894800 2005 Thiocyanate modulates the catalytic activity of mammalian peroxidases.
15316147 2004 Association of single nucleotide polymorphisms in the eosinophil peroxidase gene with Japanese cedar pollinosis.
14657871 2003 High contribution contrast between the genes of eosinophil peroxidase and IL-4 receptor alpha-chain in Japanese cedar pollinosis.
12540536 2003 Human eosinophil peroxidase induces surface alteration, killing, and lysis of Mycobacterium tuberculosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10971470 2000 Macrophage migration inhibitory factor (MIF) in bronchial asthma.
10828600 2000 The eosinophil peroxidase gene forms a cluster with the genes for myeloperoxidase and lactoperoxidase on human chromosome 17.
10386597 1999 Kinetics of peroxidases in guinea pig bone marrow under immunostimulation.
10358043 1999 Biochemical evidence for heme linkage through esters with Asp-93 and Glu-241 in human eosinophil peroxidase. The ester with Asp-93 is only partially formed in vivo.
7809065 1994 Hereditary eosinophil peroxidase deficiency: immunochemical and spectroscopic studies and evidence for a compound heterozygosity of the defect.
2550461 1989 Molecular cloning and characterization of a chromosomal gene for human eosinophil peroxidase.
2541222 1989 Molecular cloning of the human eosinophil peroxidase. Evidence for the existence of a peroxidase multigene family.