Property Summary

NCBI Gene PubMed Count 30
PubMed Score 19.68
PubTator Score 51.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.195 4.6e-03
medulloblastoma, large-cell 1.500 1.8e-04
adult high grade glioma 1.200 1.1e-03
ovarian cancer 1.200 2.6e-08

Gene RIF (15)

PMID Text
24358212 Eppin and Fibronectin bind to each other in human semen and on human ejaculated spermatozoa.
24312623 EPPIN and SEMG1 rapidly co-evolved in primates
22699487 EPPIN's semenogelin I binding site: a contraceptive drug target.
21461566 The expression of mouse EPPIN protein was detected in A1-A4 spermatogonia and the expression of human EPPIN was detected in type A spermatogonia as well as in the earliest preleptotene spermatocytes.
21392882 Letter: Eppin overexpression in prostate cancer correlates with favorable prognosis.
20488803 Different variants in the EPPIN gene are related to idiopathic male infertility and men carrying these variants have a decreased or increased risk of abnormal semen parameters associated with male infertility.
20488803 Observational study of gene-disease association. (HuGE Navigator)
20158997 Genetic variants in the Eppin gene may be associated with semen quality.
20158997 Observational study of gene-disease association. (HuGE Navigator)
19889947 Cysteine 239 of rSEMG1 appears to be the critical amino acid for both binding to eppin and inhibiting sperm motility.
19801569 Eppin can modulate intracellular calcium concentrations and subsequently affect the calcium ionophore A23187-induced acrosome reaction.
18645681 Eppin protects a 15-kDa fragment of semenogelin from hydrolysis by prostate specific antigen
18331357 although both of eppin's domains are involved in the protein's antibacterial activity, only the Kunitz domain is required for selective protease inhibition
15590901 in seminal plasma and on spermatozoa following ejaculation, Eppin is bound to semenogelin I
15229136 This antimicrobial peptide permeabilized outer and inner membranes of E. coli, consistent with its ability to induce striking morphological alterations of E. coli membranes. Has role in innate immune system of human epididymis.

AA Sequence

MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTKDRQCQDNKKCCVFSCGKKCL      1 - 70
DLKQDVCEMPKETGPCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP            71 - 133
//

Text Mined References (31)

PMID Year Title
25494938 2015 De novo assembly of the transcriptome of Acanthaster planci testes.
24358212 2013 Correlation of epididymal protease inhibitor and fibronectin in human semen.
24312623 2013 Interacting proteins on human spermatozoa: adaptive evolution of the binding of semenogelin I to EPPIN.
22699487 2012 Characterization of EPPIN's semenogelin I binding site: a contraceptive drug target.
22075473 2012 Loss of calcium in human spermatozoa via EPPIN, the semenogelin receptor.
21461566 Distribution of Eppin in mouse and human testis.
21392882 2011 Eppin expression in prostate cancer.
20800364 2010 Eppin, a novel marker to differentially diagnose azoospermia?
20505168 2010 Alterations in the human blood-epididymis barrier in obstructive azoospermia and the development of novel epididymal cell lines from infertile men.
20488803 2010 Variants of the EPPIN gene affect the risk of idiopathic male infertility in the Han-Chinese population.
20158997 2010 Variants in the Eppin gene show association with semen quality in Han-Chinese population.
20005859 2010 Screening and identification of dominant functional fragments of human epididymal protease inhibitor.
19889947 2010 Analysis of recombinant human semenogelin as an inhibitor of human sperm motility.
19801569 2010 The effect of anti-eppin antibodies on ionophore A23187-induced calcium influx and acrosome reaction of human spermatozoa.
18645681 2008 Molecular mechanism of epididymal protease inhibitor modulating the liquefaction of human semen.
18466682 2008 Purification and characterization of biologically active recombinant human Eppin expressed in Escherichia coli.
18331357 2008 Functional domains of the human epididymal protease inhibitor, eppin.
17928628 2008 Alterations in gene expression in the caput epididymides of nonobstructive azoospermic men.
17644992 2007 Eppin: a molecular strategy for male contraception.
17567961 2007 Characterization of an eppin protein complex from human semen and spermatozoa.
17566290 2007 Eppin: an epididymal protease inhibitor and a target for male contraception.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15590901 2005 Association of eppin with semenogelin on human spermatozoa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15229136 2004 Antimicrobial activity of human EPPIN, an androgen-regulated, sperm-bound protein with a whey acidic protein motif.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12909348 2003 Characterization of mouse Eppin and a gene cluster of similar protease inhibitors on mouse chromosome 2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12206714 2002 A locus on human chromosome 20 contains several genes expressing protease inhibitor domains with homology to whey acidic protein.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11404006 2001 Cloning and sequencing of human Eppin: a novel family of protease inhibitors expressed in the epididymis and testis.