| Tbio | Epsin-2 |
Plays a role in the formation of clathrin-coated invaginations and endocytosis.
This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
This gene encodes a protein which interacts with clathrin and adaptor-related protein complex 2, alpha 1 subunit. The protein is found in a brain-derived clathrin-coated vesicle fraction and localizes to the peri-Golgi region and the cell periphery. The protein is thought to be involved in clathrin-mediated endocytosis. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| pilocytic astrocytoma | 3086 | 6.0e-07 |
| cutaneous lupus erythematosus | 1056 | 1.5e-03 |
| oligodendroglioma | 2849 | 8.5e-03 |
| subependymal giant cell astrocytoma | 2287 | 4.6e-02 |
| Disease | log2 FC | p |
|---|---|---|
| oligodendroglioma | 1.400 | 8.5e-03 |
| cutaneous lupus erythematosus | -1.300 | 1.5e-03 |
| pilocytic astrocytoma | 1.700 | 6.0e-07 |
| subependymal giant cell astrocytoma | -1.011 | 4.6e-02 |
| PMID | Text | |
|---|---|---|
| 25871009 | Epsins are required for Dishevelled stability and Wnt signalling activation in colon cancer development. | |
| 22174317 | HIV-1 Rev interacting protein, epsin 2 (EPN2), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with EPN2 is increased by RRE | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) |
MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKN 1 - 70 WRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERL 71 - 140 KAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSPEASLCPQHRT 141 - 210 GAPLGQSEELQPLSQRHPFLPHLGLASRPNGDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQL 211 - 280 QLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQK 281 - 350 AEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATVQSVPKNSDPWAASQQPASS 351 - 420 AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPF 421 - 490 ESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQ 491 - 560 PLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAA 561 - 630 QATGTTNPFLL 631 - 641 //
| PMID | Year | Title | |
|---|---|---|---|
| 25871009 | 2015 | Epsin is required for Dishevelled stability and Wnt signalling activation in colon cancer development. | |
| 25468996 | 2014 | E-cadherin interactome complexity and robustness resolved by quantitative proteomics. | |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 19413330 | 2009 | Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. | |
| 18199683 | 2008 | The ubiquitin-like protein PLIC-2 is a negative regulator of G protein-coupled receptor endocytosis. | |
| 17081983 | 2006 | Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. | |
| 16625196 | 2006 | DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15345747 | 2004 | Phosphoproteomic analysis of the developing mouse brain. | |
| 15324660 | 2004 | Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization. | |
| 15231748 | 2004 | Functional proteomics mapping of a human signaling pathway. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12750376 | 2003 | A role for epsin N-terminal homology/AP180 N-terminal homology (ENTH/ANTH) domains in tubulin binding. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 12353027 | 2002 | Curvature of clathrin-coated pits driven by epsin. | |
| 10567358 | 1999 | The epsins define a family of proteins that interact with components of the clathrin coat and contain a new protein module. | |
| 10470851 | 1999 | Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. | |
| 9813051 | 1998 | Intersectin, a novel adaptor protein with two Eps15 homology and five Src homology 3 domains. | |
| 9303539 | 1997 | Binding specificity and in vivo targets of the EH domain, a novel protein-protein interaction module. |
