Property Summary

Ligand Count 5
NCBI Gene PubMed Count 34
PubMed Score 47.71
PubTator Score 39.13

Knowledge Summary

Patent (48,280)

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma 1.400 2.0e-02
group 3 medulloblastoma -1.100 4.3e-02
lung adenocarcinoma 1.400 1.2e-06
lung carcinoma 1.600 1.8e-31
non-inflammatory breast cancer -1.500 2.4e-02
non-small cell lung cancer 1.880 3.7e-22
osteosarcoma 2.140 1.1e-03
pancreatic cancer -1.300 4.5e-04
primary pancreatic ductal adenocarcinoma -1.434 4.8e-04
primitive neuroectodermal tumor 1.100 2.0e-02
psoriasis 1.600 4.7e-04

Gene RIF (17)

AA Sequence

MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPESGWEEVSGYDE      1 - 70
AMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYEADSD     71 - 140
VASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRSFGPLSKAGFYLAFQDQGACMSLISVRAFYK    141 - 210
KCASTTAGFALFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAK    211 - 280
ESQCRPCPPGSYKAKQGEGPCLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNV    281 - 350
NETSLILEWSEPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR    351 - 420
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPNGVILDYEMKY    421 - 490
FEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEFETTSERGSGAQQLQEQLPLI    491 - 560
VGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDV    561 - 630
SCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGV    631 - 700
VTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNL    701 - 770
VCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW    771 - 840
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQS    841 - 910
GMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKIL    911 - 980
SSIQDMRLQMNQTLPVQV                                                        981 - 998
//

Text Mined References (36)

PMID Year Title