Property Summary

Ligand Count 5
NCBI Gene PubMed Count 47
PubMed Score 67.68
PubTator Score 44.93

Knowledge Summary

Patent (11,737)

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.700 1.9e-03
astrocytic glioma -1.300 6.9e-03
Astrocytoma, Pilocytic -2.400 9.4e-05
Breast cancer -1.800 9.2e-11
colon cancer -3.500 3.2e-11
glioblastoma -2.200 5.0e-06
group 4 medulloblastoma -2.400 1.2e-05
head and neck cancer and chronic obstruc... -1.100 5.0e-03
interstitial cystitis -1.400 2.6e-02
intraductal papillary-mucinous adenoma (... -1.200 1.1e-03
lung cancer 4.600 8.7e-07
lung carcinoma 1.500 4.0e-06
medulloblastoma, large-cell 3.800 4.6e-05
oligodendroglioma -1.600 2.0e-02
pituitary cancer 1.100 5.0e-03
subependymal giant cell astrocytoma -1.830 3.3e-02

Gene RIF (22)

AA Sequence

MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRT      1 - 70
YQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRE     71 - 140
NLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIE    141 - 210
NLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCG    211 - 280
RGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLE    281 - 350
WSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG    351 - 420
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTY    421 - 490
STVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVIIIAV    491 - 560
VAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHFKFPGTKTYIDPETYEDPNRAVHQFAKELDA    561 - 630
SCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGV    631 - 700
VTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNL    701 - 770
VCKVSDFGLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDM    771 - 840
SNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPLGTCSRP    841 - 910
ISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVMSLGITLVGHQKKIMSS    911 - 980
IQTMRAQMLHLHGTGIQV                                                        981 - 998
//

Text Mined References (50)

PMID Year Title