Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.43
PubTator Score 24.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.198 1.8e-02
Multiple myeloma 1.934 1.7e-04
astrocytic glioma -2.000 4.8e-03
posterior fossa group B ependymoma -1.400 3.8e-10
oligodendroglioma -1.300 2.6e-02
glioblastoma -1.600 2.7e-02
group 4 medulloblastoma -1.700 1.5e-04
medulloblastoma, large-cell -1.100 2.6e-02
primitive neuroectodermal tumor -1.100 1.3e-02
intraductal papillary-mucinous adenoma (... 1.200 3.6e-03
intraductal papillary-mucinous carcinoma... 1.100 3.3e-03
Breast cancer 2.400 4.5e-02
adult high grade glioma -1.400 1.5e-06
atypical teratoid/rhabdoid tumor -1.100 1.4e-06
psoriasis 1.200 1.2e-34
subependymal giant cell astrocytoma -1.235 3.9e-02
ductal carcinoma in situ 1.100 9.5e-03
ovarian cancer 1.300 5.8e-03

Gene RIF (5)

PMID Text
24391510 Taken together our results suggest a hierarchy of phosphatases coordinating Greatwall, Ensa/ARPP19 and Cdk substrate dephosphorylation during mitotic exit.
24211627 Overexpressed ENSA suppresses tumor growth in an established hepatic cell line whereas hypermethylated ENSA might help maintain liver cancer initiating cells.
14728987 The ENSA gene on 1q21 produces several alternatively spliced transcripts, and is located within a region linked with T2DM in diverse populations including the Pima Indians
14728986 We mapped ENSA in silico to chromosome 1q21 near a confirmed type 2 diabetes susceptibility locus, and derived the genomic structure of four exons and three introns.
11771735 The considerably decreased alpha-endosulfine could result in the continuous opening of K(ATP) channels and the subsequent decrease of neurotransmitters release associated with cognition in Down Syndrome.

AA Sequence

MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDY      1 - 70
NMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE                        71 - 121
//

Text Mined References (27)

PMID Year Title
24391510 2014 PP2A/B55 and Fcp1 regulate Greatwall and Ensa dephosphorylation during mitotic exit.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211627 2013 ENSA expression correlates with attenuated tumor propagation in liver cancer.
23585552 2013 Genome-wide association study identifies genetic risk underlying primary rhegmatogenous retinal detachment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18973346 2008 Membrane-induced folding of the cAMP-regulated phosphoprotein endosulfine-alpha.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17893145 2007 Conformation-specific binding of alpha-synuclein to novel protein partners detected by phage display and NMR spectroscopy.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15030171 2004 Molecular characterization of a local sulfonylurea system in human adipose tissue.
14728987 2004 The transcribed endosulfine alpha gene is located within a type 2 diabetes-linked region on 1q: sequence and expression analysis in Pima Indians.
14728986 2004 Alpha-endosulfine, a positional and functional candidate gene for type 2 diabetes: molecular screening, association studies, and role in reduced insulin secretion.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12937617 2000 Endosulfines: Novel regulators of insulin secretion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10480622 1999 Isolation, characterization, and chromosomal localization of the human ENSA gene that encodes alpha-endosulfine, a regulator of beta-cell K(ATP) channels.
9653196 1998 Human alpha-endosulfine, a possible regulator of sulfonylurea-sensitive KATP channel: molecular cloning, expression and biological properties.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.