Property Summary

Ligand Count 43
NCBI Gene PubMed Count 43
PubMed Score 655.71
PubTator Score 745.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
chronic rhinosinusitis -1.811 2.1e-02
ependymoma 1.400 5.2e-05
gastric carcinoma 1.300 4.6e-02
glioblastoma 1.300 5.0e-03
group 3 medulloblastoma 1.500 3.9e-03
interstitial cystitis 1.100 1.1e-02
intraductal papillary-mucinous adenoma (... -1.900 1.5e-03
intraductal papillary-mucinous carcinoma... -1.700 4.0e-03
intraductal papillary-mucinous neoplasm ... -1.600 3.6e-02
invasive ductal carcinoma -1.174 3.4e-03
lung cancer -1.200 8.1e-04
osteosarcoma -1.740 4.2e-02
pancreatic ductal adenocarcinoma liver m... -2.292 1.7e-03
pediatric high grade glioma 1.200 7.5e-04
psoriasis -1.900 1.3e-04

Gene RIF (19)

AA Sequence

MNFAEREGSKRYCIQTKHVAILCAVVVGVGLIVGLAVGLTRSCDSSGDGGPGTAPAPSHLPSSTASPSGP      1 - 70
PAQDQDICPASEDESGQWKNFRLPDFVNPVHYDLHVKPLLEEDTYTGTVSISINLSAPTRYLWLHLRETR     71 - 140
ITRLPELKRPSGDQVQVRRCFEYKKQEYVVVEAEEELTPSSGDGLYLLTMEFAGWLNGSLVGFYRTTYTE    141 - 210
NGQVKSIVATDHEPTDARKSFPCFDEPNKKATYTISITHPKEYGALSNMPVAKEESVDDKWTRTTFEKSV    211 - 280
PMSTYLVCFAVHQFDSVKRISNSGKPLTIYVQPEQKHTAEYAANITKSVFDYFEEYFAMNYSLPKLDKIA    281 - 350
IPDFGTGAMENWGLITYRETNLLYDPKESASSNQQRVATVVAHELVHQWFGNIVTMDWWEDLWLNEGFAS    351 - 420
FFEFLGVNHAETDWQMRDQMLLEDVLPVQEDDSLMSSHPIIVTVTTPDEITSVFDGISYSKGSSILRMLE    421 - 490
DWIKPENFQKGCQMYLEKYQFKNAKTSDFWAALEEASRLPVKEVMDTWTRQMGYPVLNVNGVKNITQKRF    491 - 560
LLDPRANPSQPPSDLGYTWNIPVKWTEDNITSSVLFNRSEKEGITLNSSNPSGNAFLKINPDHIGFYRVN    561 - 630
YEVATWDSIATALSLNHKTFSSADRASLIDDAFALARAQLLDYKVALNLTKYLKREENFLPWQRVISAVT    631 - 700
YIISMFEDDKELYPMIEEYFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQ    701 - 770
WLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLK    771 - 840
DTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMES    841 - 910
FFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREWFFNLLESG                           911 - 957
//

Text Mined References (47)

PMID Year Title