Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.05
PubTator Score 24.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.100 2.8e-02
chronic rhinosinusitis -1.087 5.1e-03
glioblastoma -1.400 5.9e-03
ovarian cancer -1.100 2.4e-09
pediatric high grade glioma -1.100 4.8e-03
Pick disease -1.100 3.1e-03
pituitary cancer 1.600 1.3e-03

Gene RIF (4)

AA Sequence

MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWATAMNNLGMVPVGLPGQQLVSD      1 - 70
SICVPGFDPSLNMMTGITPINPMIPGLGLVPPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPG     71 - 140
CKTVFVGGLPENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRMRLGSSTDKKD    141 - 210
SGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRLRPPSPPAIMHYSEHEAALLAEKLKDDSKFS    211 - 280
EAITVLLSWIERGEVNRRSANQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV    281 - 350
AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEMEMSDDENCDSPTKKMRVDES    351 - 420
ALAAQAYALKEENDSLRWQLDAYRNEVELLKQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEE    421 - 490
LNNKKSELEQAKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQDRENNIEKRSQ    491 - 560
GLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSKISANEIEMLLMRLPRMFKQEFTGVGATLEK    561 - 630
RWKLCAFEGIKTT                                                             631 - 643
//

Text Mined References (22)

PMID Year Title