Property Summary

NCBI Gene PubMed Count 20
PubMed Score 116.53
PubTator Score 35.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma 2.342 3.0e-03
astrocytic glioma -2.500 4.7e-02
Astrocytoma, Pilocytic -2.900 3.4e-04
atypical teratoid / rhabdoid tumor -2.100 3.6e-02
Breast cancer 1.300 3.3e-02
colon cancer 1.900 2.4e-03
ductal carcinoma in situ 2.000 1.2e-03
ependymoma -4.200 4.7e-03
esophageal adenocarcinoma 1.600 2.9e-02
gastric carcinoma 1.700 2.2e-02
glioblastoma -1.900 9.7e-04
invasive ductal carcinoma 1.435 5.9e-05
lung adenocarcinoma 1.400 6.9e-06
lung carcinoma 1.100 1.6e-14
malignant mesothelioma -2.400 7.4e-06
medulloblastoma, large-cell -3.600 7.7e-03
oligodendroglioma -2.500 3.9e-02
osteosarcoma 3.230 3.7e-05
ovarian cancer 2.700 3.1e-04
pancreatic cancer 1.100 3.0e-03
pancreatic ductal adenocarcinoma liver m... 1.947 1.9e-02
Parkinson's disease -2.100 1.9e-02
pediatric high grade glioma -1.500 2.1e-02
Pick disease -2.500 1.3e-02
pituitary cancer -1.200 2.4e-03
psoriasis -1.300 6.9e-08
Rheumatoid arthritis 1.700 4.7e-03
sonic hedgehog group medulloblastoma -2.100 4.7e-02
ulcerative colitis 1.500 1.4e-04

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCHRAVLAACSRY      1 - 70
FEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESLLEAGDMLEFQDIRDACAEFL     71 - 140
EKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIRKNEDFLQLPQDMVVQLLSSEELETEDERLV    141 - 210
YESAINWISYDLKKRYCYLPELLQTVRLALLPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQND    211 - 280
GVVTSLCARPRKTGHALFLLGGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAIGCKVYITGGRGS    281 - 350
ENGVSKDVWVYDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT    351 - 420
INKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVL    421 - 490
GNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKLYVVGGYFGIQRCKTLDCYDP    491 - 560
TLDVWNSITTVPYSLIPTAFVSTWKHLPS                                             561 - 589
//

Text Mined References (22)

PMID Year Title