Property Summary

NCBI Gene PubMed Count 30
PubMed Score 48.20
PubTator Score 30.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.128 3.4e-02
astrocytic glioma -2.800 4.4e-02
atypical teratoid / rhabdoid tumor -1.200 4.2e-03
Breast cancer 2.800 2.5e-02
COPD 1.200 2.0e-02
ductal carcinoma in situ 1.200 8.4e-03
glioblastoma -1.300 9.1e-04
group 3 medulloblastoma 2.200 1.2e-02
interstitial cystitis 1.100 9.8e-04
invasive ductal carcinoma 2.000 1.7e-03
lung adenocarcinoma 1.100 8.3e-08
medulloblastoma, large-cell -1.700 2.6e-05
osteosarcoma -4.119 3.2e-06
ovarian cancer 1.200 3.8e-10
pancreatic cancer 1.600 1.0e-02
pancreatic carcinoma 1.600 1.0e-02

Protein-protein Interaction (1)

Gene RIF (21)

AA Sequence

MALKKSSPSLDSGDSDSEELPTFAFLKKEPSSTKRRQPEREEKIVVVDISDCEASCPPAPELFSPPVPEI      1 - 70
AETVTQTQPVRLLSSESEDEEEFIPLAQRLTCKFLTHKQLSPEDSSSPVKSVLDHQNNEGASCDWKKPFP     71 - 140
KIPEVPLHDTPERSAADNKDLILDPCCQLPAYLSTCPGQSSSLAVTKTNSDILPPQKKTKPSQKVQGRGS    141 - 210
HGCRQQRQARQKESTLRRQERKNAALVTRMKAQRPEECLKHIIVVLDPVLLQMEGGGQLLGALQTMECRC    211 - 280
VIEAQAVPCSVTWRRRAGPSEDREDWVEEPTVLVLLRAEAFVSMIDNGKQGSLDSTMKGKETLQGFVTDI    281 - 350
TAKTAGKALSLVIVDQEKCFSAQNPPRRGKQGANKQTKKQQQRQPEASIGSMVSRVDAEEALVDLQLHTE    351 - 420
AQAQIVQSWKELADFTCAFTKAVAEAPFKKLRDETTFSFCLESDWAGGVKVDLAGRGLALVWRRQIQQLN    421 - 490
RVSLEMASAVVNAYPSPQLLVQAYQQCFSDKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTL    491 - 560
QPHLSLDSAD                                                                561 - 570
//

Text Mined References (38)

PMID Year Title