Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.41
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 2.6e-05
lung cancer 4740 4.5e-05
Breast cancer 3578 8.1e-05
non primary Sjogren syndrome sicca 891 1.2e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.200 8.1e-05
lung cancer 1.700 4.5e-05
non primary Sjogren syndrome sicca 1.200 1.2e-02
ovarian cancer 1.500 2.6e-05

Synonym

Accession O43402 C9JB21
Symbols NOC4
COX4NB
C16orf2
C16orf4
FAM158B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPM      1 - 70
LEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPT     71 - 140
IHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC    141 - 210
//

Text Mined References (15)

PMID Year Title