Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.65
PubTator Score 2.92

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8297 1.0e-03


  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.0e-03


Accession Q9BV81
Symbols TMEM93


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

GRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY                                   71 - 110

Text Mined References (7)

PMID Year Title