Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.65
PubTator Score 2.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.0e-03

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.200 1.0e-03

Gene RIF (1)

AA Sequence

MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASVLLSLLLILKA      1 - 70
GRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY                                   71 - 110
//

Text Mined References (7)

PMID Year Title