Property Summary

NCBI Gene PubMed Count 11
PubMed Score 63.22
PubTator Score 17.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.200 3.4e-04
astrocytic glioma -1.200 3.8e-02
atypical teratoid / rhabdoid tumor -1.700 1.5e-09
Breast cancer 1.900 3.5e-02
ependymoma -1.500 2.9e-02
glioblastoma -1.400 2.4e-04
group 4 medulloblastoma -1.200 9.5e-05
medulloblastoma, large-cell -1.300 1.1e-04
Multiple myeloma 1.092 8.5e-03
oligodendroglioma -1.200 4.1e-02
osteosarcoma -2.261 4.7e-06
ovarian cancer 1.500 3.7e-04
pancreatic ductal adenocarcinoma liver m... -1.196 1.3e-03
primitive neuroectodermal tumor -1.300 1.6e-03

AA Sequence

MAGPELLLDSNIRLWVVLPIVIITFFVGMIRHYVSILLQSDKKLTQEQVSDSQVLIRSRVLRENGKYIPK      1 - 70
QSFLTRKYYFNNPEDGFFKKTKRKVVPPSPMTDPTMLTDMMKGNVTNVLPMILIGGWINMTFSGFVTTKV     71 - 140
PFPLTLRFKPMLQQGIELLTLDASWVSSASWYFLNVFGLRSIYSLILGQDNAADQSRMMQEQMTGAAMAM    141 - 210
PADTNKAFKTEWEALELTDHQWALDDVEEELMAKDLHFEGMFKKELQTSIF                       211 - 261
//

Text Mined References (14)

PMID Year Title