Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.59
PubTator Score 1.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 5.6e-06
medulloblastoma, large-cell 6234 1.2e-04
medulloblastoma 1524 8.9e-04
Down syndrome 548 1.9e-03
dermatomyositis 966 4.3e-03
progressive supranuclear palsy 674 2.9e-02
lung cancer 4473 4.0e-02
Disease Target Count Z-score Confidence
Graves' disease 25 3.41 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
medulloblastoma -1.200 8.9e-04
medulloblastoma, large-cell -1.500 1.2e-04
lung cancer 1.100 4.0e-02
progressive supranuclear palsy -1.100 2.9e-02
ovarian cancer 2.800 5.6e-06
Down syndrome 1.200 1.9e-03
dermatomyositis 1.300 4.3e-03

Synonym

Accession Q15006 Q8WUE1
Symbols TTC35
KIAA0103

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAKVSELYDVTWEEMRDKMRKWREENSRNSEQIVEVGEELINEYASKLGDDIWIIYEQVMIAALDYGRDD      1 - 70
LALFCLQELRRQFPGSHRVKRLTGMRFEAMERYDDAIQLYDRILQEDPTNTAARKRKIAIRKAQGKNVEA     71 - 140
IRELNEYLEQFVGDQEAWHELAELYINEHDYAKAAFCLEELMMTNPHNHLYCQQYAEVKYTQGGLENLEL    141 - 210
SRKYFAQALKLNNRNMRALFGLYMSASHIASNPKASAKTKKDNMKYASWAASQINRAYQFAGRSKKETKY    211 - 280
SLKAVEDMLETLQITQS                                                         281 - 297
//

Text Mined References (19)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26190106 2015 A CRISPR-Based Screen Identifies Genes Essential for West-Nile-Virus-Induced Cell Death.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25064007 2014 A genome-wide association study identifies susceptibility loci for ossification of the posterior longitudinal ligament of the spine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11593002 2001 Nuclear envelope proteomics: novel integral membrane proteins of the inner nuclear membrane.
10942595 2000 A visual intracellular classification strategy for uncharacterized human proteins.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7788527 1995 Prediction of the coding sequences of unidentified human genes. III. The coding sequences of 40 new genes (KIAA0081-KIAA0120) deduced by analysis of cDNA clones from human cell line KG-1.