Property Summary

NCBI Gene PubMed Count 30
PubMed Score 72.31
PubTator Score 20.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.401 3.2e-02
Multiple myeloma 1.332 2.4e-02
psoriasis 2.200 6.4e-04
osteosarcoma -1.036 8.8e-04
Duchenne muscular dystrophy 1.532 1.9e-08
autosomal dominant Emery-Dreifuss muscul... 1.655 3.9e-03
juvenile dermatomyositis 1.261 7.0e-10
acute quadriplegic myopathy 1.531 4.2e-06
Atopic dermatitis -1.400 5.1e-03
primary pancreatic ductal adenocarcinoma 1.984 3.0e-03
lung cancer -1.100 4.3e-03
active Crohn's disease 3.321 4.7e-04
ulcerative colitis 3.000 3.9e-07
Breast cancer 4.000 2.7e-02
interstitial cystitis 1.300 3.2e-05
primary Sjogren syndrome 1.600 4.6e-03
gastric carcinoma 2.000 4.6e-03
invasive ductal carcinoma -1.100 2.5e-02
ovarian cancer -2.400 2.3e-05
chronic rhinosinusitis -1.175 1.6e-02
cystic fibrosis and chronic rhinosinusit... -1.110 3.8e-02
pancreatic cancer 2.100 1.0e-03
dermatomyositis 2.100 3.2e-04

Protein-protein Interaction (2)

Gene RIF (12)

PMID Text
26433464 SCA38 subtype is very rare in Mainland China; no disease-related gene mutations in ELOVL5.
26321664 performed a detailed promoter/enhancer analysis of ELOVL5 gene, and identified two new SREBP binding sites, one in the 10 kb upstream region and one in the exon 1
25065913 In transfection experiments, subcellular localization of altered ELOVL5 showed a perinuclear distribution with a signal increase in the Golgi compartment, whereas the wild-type showed a widespread signal in the endoplasmic reticulum.
24167612 Changes in the mRNA-expression levels of FADS1 and 2 directly affect blood DGLA levels and D6D activity. This study suggests that lower mRNA-expressions of FADS2 and ELOVL5 are associated with higher risk of atopic eczema in young children.
23099444 a novel link between Elovl5-mediated synthesis of 18:1,n-7 and GNG through the control of the mTORC2-Akt-FoxO1 pathway
22293571 minor allele copies at rs2294867 associated with an increase in total and LDL cholesterol...number of minor allele copies at rs761179 associated with increase in total cholesterol... However, associations not replicated in independent populations.
21508110 Typical POAG associated with ELOVL5 gene polymorphism may have a late rather than an early onset.
21383846 Not being breastfed resulted in a disadvantage in cognition (5 to 8 points) among children CC homozygote for rs2397142 (low ELOVL5 activity), but not among those carrying the G allele.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20363506 Our genome-wide association study identified SRBD1 and ELOVL5 as new susceptibility genes for (normal tension glaucoma) NTG.
20363506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNL      1 - 70
GLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQIT     71 - 140
VLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQLLQF    141 - 210
VLTIIQTSCGVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGH    211 - 280
TNSFSPLENNVKPRKLRKD                                                       281 - 299
//

Text Mined References (35)

PMID Year Title
26433464 2015 SCA38 is rare in Mainland China.
26321664 2015 Identification of human ELOVL5 enhancer regions controlled by SREBP.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25065913 2014 ELOVL5 mutations cause spinocerebellar ataxia 38.
24167612 2013 Gene expression of desaturase (FADS1 and FADS2) and Elongase (ELOVL5) enzymes in peripheral blood: association with polyunsaturated fatty acid levels and atopic eczema in 4-year-old children.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23099444 2013 Elovl5 regulates the mTORC2-Akt-FOXO1 pathway by controlling hepatic cis-vaccenic acid synthesis in diet-induced obese mice.
22293571 2012 Genetic variation in fatty acid elongases is not associated with intermediate cardiovascular phenotypes or myocardial infarction.
21508110 2011 Association between SRBD1 and ELOVL5 gene polymorphisms and primary open-angle glaucoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21383846 2011 Genetic variants of the FADS gene cluster and ELOVL gene family, colostrums LC-PUFA levels, breastfeeding, and child cognition.
20937905 2010 ELOVL1 production of C24 acyl-CoAs is linked to C24 sphingolipid synthesis.
20427700 2010 Validation of the health ABC heart failure model for incident heart failure risk prediction: the Cardiovascular Health Study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20363506 2010 Genome-wide association study of normal tension glaucoma: common variants in SRBD1 and ELOVL5 contribute to disease susceptibility.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16273301 2005 Mutation screening of three candidate genes, ELOVL5, SMAP1 and GLULD1 in autosomal recessive retinitis pigmentosa.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14636670 2004 Elongation of long-chain fatty acids.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12371743 2002 Identification and expression of mammalian long-chain PUFA elongation enzymes.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10970790 2000 Cloning of a human cDNA encoding a novel enzyme involved in the elongation of long-chain polyunsaturated fatty acids.
9110174 1997 Large-scale concatenation cDNA sequencing.
8944226 1996 Biosynthesis of triacylglycerols.
8619474 1996 A "double adaptor" method for improved shotgun library construction.