Property Summary

NCBI Gene PubMed Count 68
PubMed Score 47.16
PubTator Score 20.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Renal Cell Carcinoma 199
Disease Target Count P-value
Breast cancer 3098 1.3e-05
Multiple myeloma 1327 2.7e-04
ovarian cancer 8491 3.1e-04
astrocytoma 1493 1.1e-03
dermatomyositis 966 7.3e-03
invasive ductal carcinoma 2950 1.3e-02
Disease Target Count Z-score Confidence
Hemangioma 35 4.163 2.1

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 2.221 2.7e-04
astrocytoma -1.400 1.1e-03
invasive ductal carcinoma 1.200 1.3e-02
ovarian cancer 2.400 3.1e-04
Breast cancer 1.200 1.3e-05
dermatomyositis 1.100 7.3e-03

Synonym

Accession Q15369 E5RGD9 Q567Q6
Symbols SIII
TCEB1

Gene

PANTHER Protein Class (1)

PDB

2IZV   4WQO   1LM8   1LQB   1VCB   3ZRC   3ZRF   3ZTC   3ZTD   3ZUN   4AJY   4AWJ   4B95   4B9K   4BKS   4BKT   4W9C   4W9D   4W9E   4W9F   4W9G   4W9H   4W9I   4W9J   4W9K   4W9L   4N9F   2C9W   5BO4   3ZKJ   3ZNG   2MA9   3DCG  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (56)

PMID Text
26241003 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
26121586 crystals of SOCS2 in complex with its adaptor proteins, Elongin C and Elongin B, underwent a change in crystallographic parameters when treated with dimethyl sulfoxide during soaking experiments.
25981045 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25676555 TCEB1-mutated renal cell carcinoma is a distinct entity with recurrent hotspot mutations, specific copy number alterations, pathway activation, and characteristic morphological features.
25661653 The crystal structure of VHL bound to a Cul2 N-terminal domain, Elongin B, and Elongin C.
25408426 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
25124760 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
24586532 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
24402281 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
24402277 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
24367103 AFF1 is a ubiquitous P-TEFb partner; full Tat transactivation requires the complete super elongation complexes
24225024 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
23988114 Vif interaction with EloB-EloC may contribute to recruitment of CBF-beta to Vif, demonstrating that the EloB C-teminus may play a role in improving Vif function and that the over-expression of EloB results in Vif stabilization.
23988114 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
23837592 ASB9 is unstable alone but forms a stable ternary complex with EloBC that binds with high affinity to the Cullin 5 N-terminal domain.
23621690 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
23460923 PRAME expression in leukaemic cell lines is upregulated by IFN gamma and LPS, suggesting a possible role in immune responses. PRAME associates with Elongin BC complexes by binding Elongin C.
23405965 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
23378232 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
23333304 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
23083832 TCEB1 and SELC14L1 are good candidate markers for predicting prognosis and progression of prostate cancer.
22379088 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
22190037 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
22190036 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
22190034 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
22001063 Functional interaction of Notch4(ICD) and Elongin C provides novel insight into regulation of Notch signaling in epithelial cell biology and disease.
20728451 Recombinant full-length Vif interacted with the Elongin BC complex in vitro with a K(d) of 1.9 muM and resulted in observable changes in deuterium uptake in both Elongin C and B.
20728451 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
20532212 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
20463065 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
20450485 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20174454 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
20096141 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
19218568 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
19038776 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
19008196 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
18844214 TCEB1 promotes invasion of prostate cancer cells and is involved in development of hormone-refractory prostate cancer
18789977 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
18562529 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
18541215 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
18508766 Elongin B/C recruitment regulates substrate binding by CIS
18499212 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
17285170 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
16675548 Results describe the 1.9-A crystal structure of the ternary complex of SOCS2 with elongin C and elongin B.
16303161 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
15781449 the E3 ubiquitin ligase activity of the Vif-BC-Cul5 complex is essential for Vif function against APOBEC3G
15590664 show that ASB2, by interacting with the Elongin BC complex, can assemble with Cullin5.Rbx1 to form an E3 ubiquitin ligase complex that stimulates polyubiquitination by the E2 ubiquitin-conjugating enzyme Ubc5
15574593 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
15574592 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
15280393 specific Elongin C and Skp1 sequences determine Cullin selection
14564014 findings report that HIV-1 Vif interacts with cellular proteins Cul5, elongins B and C, and Rbx1 to form an Skp1-cullin-F-box (SCF)-like complex
14564014 HIV-1 Vif interacts with TCEB1 (Elongin C) as demonstrated by co-immunoprecipitation assay
12004003 These findings suggest that Elongin c may be one of the target genes for amplification of 8q21

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL      1 - 70
SKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC                                 71 - 112
//

Text Mined References (78)

PMID Year Title
26121586 2015 Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
25676555 2015 TCEB1-mutated renal cell carcinoma: a distinct genomic and morphological subtype.
25661653 2015 Insights into Cullin-RING E3 ubiquitin ligase recruitment: structure of the VHL-EloBC-Cul2 complex.
25416956 2014 A proteome-scale map of the human interactome network.
24367103 2014 AFF1 is a ubiquitous P-TEFb partner to enable Tat extraction of P-TEFb from 7SK snRNP and formation of SECs for HIV transactivation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23988114 2013 Interactions between HIV-1 Vif and human ElonginB-ElonginC are important for CBF-? binding to Vif.
23837592 2013 Multimeric complexes among ankyrin-repeat and SOCS-box protein 9 (ASB9), ElonginBC, and Cullin 5: insights into the structure and assembly of ECS-type Cullin-RING E3 ubiquitin ligases.
23563313 2013 CCDC22 deficiency in humans blunts activation of proinflammatory NF-?B signaling.
23460923 2013 PRAME is a golgi-targeted protein that associates with the Elongin BC complex and is upregulated by interferon-gamma and bacterial PAMPs.
23102700 2012 The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.
23083832 2012 A 12-gene expression signature is associated with aggressive histological in prostate cancer: SEC14L1 and TCEB1 genes are potential markers of progression.
22190034 2011 Global landscape of HIV-human protein complexes.
22001063 2011 Elongin C is a mediator of Notch4 activity in human renal tubule cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20871634 2011 Regulation of receptor for activated C kinase 1 protein by the von Hippel-Lindau tumor suppressor in IGF-I-induced renal carcinoma cell invasiveness.
20732625 2010 Meta-analysis of genome-wide association studies of attention-deficit/hyperactivity disorder.
20728451 2010 Molecular insight into the conformational dynamics of the Elongin BC complex and its interaction with HIV-1 Vif.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19327355 2009 Requirement for microtubule integrity in the SOCS1-mediated intracellular dynamics of HIV-1 Gag.
19322197 2009 Termination of NF-kappaB activity through a gammaherpesvirus protein that assembles an EC5S ubiquitin-ligase.
19159283 2009 Array MAPPIT: high-throughput interactome analysis in mammalian cells.
18844214 2009 TCEB1 promotes invasion of prostate cancer cells.
18508766 2008 Elongin B/C recruitment regulates substrate binding by CIS.
18323857 2008 NEDD8 acts as a 'molecular switch' defining the functional selectivity of VHL.
17997974 2007 Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17251292 2007 Respiratory syncytial virus NS1 protein degrades STAT2 by using the Elongin-Cullin E3 ligase.
17189197 2006 Structural basis for protein recognition by B30.2/SPRY domains.
17183367 2007 COMMD1 promotes the ubiquitination of NF-kappaB subunits through a cullin-containing ubiquitin ligase.
16675548 2006 Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
16643902 2006 The E3 ubiquitin ligase HOIL-1 induces the polyubiquitination and degradation of SOCS6 associated proteins.
16503656 2006 Analysis of Nedd8-associated polypeptides: a model for deciphering the pathway for ubiquitin-like modifications.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15781449 2005 Ubiquitination of APOBEC3G by an HIV-1 Vif-Cullin5-Elongin B-Elongin C complex is essential for Vif function.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15590694 2005 Suppressors of cytokine signaling 4 and 5 regulate epidermal growth factor receptor signaling.
15590664 2005 ASB2 is an Elongin BC-interacting protein that can assemble with Cullin 5 and Rbx1 to reconstitute an E3 ubiquitin ligase complex.
15574592 2004 Phosphorylation of a novel SOCS-box regulates assembly of the HIV-1 Vif-Cul5 complex that promotes APOBEC3G degradation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467733 2004 TMF/ARA160 is a BC-box-containing protein that mediates the degradation of Stat3.
15280393 2004 Identification of Elongin C and Skp1 sequences that determine Cullin selection.
14960280 2004 Ozz-E3, a muscle-specific ubiquitin ligase, regulates beta-catenin degradation during myogenesis.
14564014 2003 Induction of APOBEC3G ubiquitination and degradation by an HIV-1 Vif-Cul5-SCF complex.
12943681 2003 Identification of EloA-BP1, a novel Elongin A binding protein with an exonuclease homology domain.
12676794 2003 The RNA polymerase II elongation complex.
12559969 2003 Molecular cloning and characterization of the human ASB-8 gene encoding a novel member of ankyrin repeat and SOCS box containing protein family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12149480 2002 Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase.
12052866 2002 SOCS-6 binds to insulin receptor substrate 4, and mice lacking the SOCS-6 gene exhibit mild growth retardation.
12050673 2002 Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.
12004076 2002 Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling.
12004003 2002 Amplification and overexpression of Elongin C gene discovered in prostate cancer by cDNA microarrays.
11994304 2002 Identification and biochemical characterization of a novel transcription elongation factor, Elongin A3.
11739384 2002 Ubiquitination of a novel deubiquitinating enzyme requires direct binding to von Hippel-Lindau tumor suppressor protein.
11384984 2001 Muf1, a novel Elongin BC-interacting leucine-rich repeat protein that can assemble with Cul5 and Rbx1 to reconstitute a ubiquitin ligase.
11006129 2000 Drosophila von Hippel-Lindau tumor suppressor complex possesses E3 ubiquitin ligase activity.
10973499 2000 Activation of HIF1alpha ubiquitination by a reconstituted von Hippel-Lindau (VHL) tumor suppressor complex.
10851083 2000 Tracheal development and the von Hippel-Lindau tumor suppressor homolog in Drosophila.
10692460 2000 Identification and characterization of Elongin A2, a new member of the Elongin family of transcription elongation factors, specifically expressed in the testis.
10587522 1999 Synthetic peptides define critical contacts between elongin C, elongin B, and the von Hippel-Lindau protein.
10535940 1999 Identification of the von Hippel-lindau tumor-suppressor protein as part of an active E3 ubiquitin ligase complex.
10449727 1999 Studying interactions of four proteins in the yeast two-hybrid system: structural resemblance of the pVHL/elongin BC/hCUL-2 complex with the ubiquitin ligase complex SKP1/cullin/F-box protein.
10205047 1999 Structure of the VHL-ElonginC-ElonginB complex: implications for VHL tumor suppressor function.
10051596 1999 The conserved SOCS box motif in suppressors of cytokine signaling binds to elongins B and C and may couple bound proteins to proteasomal degradation.
9447969 1998 Regulation of hypoxia-inducible mRNAs by the von Hippel-Lindau tumor suppressor protein requires binding to complexes containing elongins B/C and Cul2.
9122164 1997 The von Hippel-Lindau tumor-suppressor gene product forms a stable complex with human CUL-2, a member of the Cdc53 family of proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8244996 1993 RNA polymerase II transcription factor SIII. I. Identification, purification, and properties.
7821821 1994 A human cDNA encoding the small subunit of RNA polymerase II transcription factor SIII.
7660130 1995 Binding of the von Hippel-Lindau tumor suppressor protein to Elongin B and C.
7660129 1995 Elongin (SIII): a multisubunit regulator of elongation by RNA polymerase II.
7660122 1995 Inhibition of transcription elongation by the VHL tumor suppressor protein.