Property Summary

NCBI Gene PubMed Count 68
PubMed Score 49.53
PubTator Score 20.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
Breast cancer 3578 1.3e-05
Multiple myeloma 1332 2.7e-04
ovarian cancer 8520 3.1e-04
astrocytoma 1146 1.1e-03
dermatomyositis 966 7.3e-03
invasive ductal carcinoma 2951 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Hemangioma 69 3.987 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.400 1.1e-03
Breast cancer 1.200 1.3e-05
dermatomyositis 1.100 7.3e-03
invasive ductal carcinoma 1.200 1.3e-02
Multiple myeloma 2.221 2.7e-04
ovarian cancer 2.400 3.1e-04

Protein-protein Interaction (4)

PDB (44)

Gene RIF (57)

AA Sequence

MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVL      1 - 70
SKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC                                 71 - 112
//

Text Mined References (78)

PMID Year Title