Property Summary

NCBI Gene PubMed Count 22
PubMed Score 8.39
PubTator Score 4.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.100 1.0e-02
ependymoma 1.100 5.7e-03
oligodendroglioma 1.100 1.7e-03
esophageal adenocarcinoma -1.100 2.0e-02
atypical teratoid / rhabdoid tumor -1.400 6.1e-05
medulloblastoma, large-cell -1.600 5.4e-04
group 4 medulloblastoma 1.200 1.1e-02
subependymal giant cell astrocytoma -2.438 2.6e-03
Pick disease -1.100 6.2e-04
ovarian cancer 2.200 5.0e-07

Gene RIF (4)

PMID Text
25332238 Axl has a role in phosphorylating the Elmo scaffold proteins to promote Rac activation and cell invasion
23184944 uncovered a role for ELMO in the recruitment of ACF7 to the membrane to promote microtubule capture and stability
22568984 Through its association with ELMO2, ILK plays key roles in the regulation of Rho GTPases and cross-talk pathways between adhesion and growth factor receptors.
18602983 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEYYTLRYADGPQLYITEQTRSDIK      1 - 70
NGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLL     71 - 140
SHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVSILQRSLAILESMVLNSQSLYQK    141 - 210
IAEEITVGQLISHLQVSNQEIQTYAIALINALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKT    211 - 280
EMAHQLYVLQVLTFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDAESDPSNAPGSGTEKRKAMYTKDYK    281 - 350
MLGFTNHINPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI    351 - 420
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQITRALPSKPN    421 - 490
SLDQFKSKLRSLSYSEILRLRQSERMSQDDFQSPPIVELREKIQPEILELIKQQRLNRLCEGSSFRKIGN    491 - 560
RRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEKIPVADIKAIVTGKDCPHMKEKSALKQNKEV    561 - 630
LELAFSILYDPDETLNFIAPNKYEYCIWIDGLSALLGKDMSSELTKSDLDTLLSMEMKLRLLDLENIQIP    631 - 700
EAPPPIPKEPSSYDFVYHYG                                                      701 - 720
//

Text Mined References (24)

PMID Year Title
25332238 2015 Axl phosphorylates Elmo scaffold proteins to promote Rac activation and cell invasion.
24567399 2014 G-protein coupled receptor BAI3 promotes myoblast fusion in vertebrates.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184944 2013 ELMO recruits actin cross-linking family 7 (ACF7) at the cell membrane for microtubule capture and stabilization of cellular protrusions.
22568984 Emerging role of ILK and ELMO2 in the integration of adhesion and migration pathways.
21269460 2011 Initial characterization of the human central proteome.
20679435 2010 Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.
18602983 2008 Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15809229 2005 Comparative gene finding in chicken indicates that we are closing in on the set of multi-exonic widely expressed human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12879077 2003 RhoG activates Rac1 by direct interaction with the Dock180-binding protein Elmo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11703939 2001 The C. elegans PH domain protein CED-12 regulates cytoskeletal reorganization via a Rho/Rac GTPase signaling pathway.
11595183 2001 CED-12/ELMO, a novel member of the CrkII/Dock180/Rac pathway, is required for phagocytosis and cell migration.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.