Property Summary

NCBI Gene PubMed Count 135
PubMed Score 2.39
PubTator Score 136.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7933 2.8e-05
astrocytoma 1493 1.1e-03
subependymal giant cell astrocytoma 2287 1.1e-02

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.335 2.8e-05
astrocytoma -1.200 1.1e-03
subependymal giant cell astrocytoma -1.278 1.1e-02

Gene RIF (81)

PMID Text
26864615 ELK1 is likely to be activated in prostate cancer cells and promote tumor progression. Furthermore, silodosin that inactivates ELK1 in prostate cancer cells not only inhibits their growth but also enhances the cytotoxic activity of gemcitabine.
26861876 These data reveal a novel role for Elk1 regulating ITGB6 expression and highlight how dysregulation of Elk1 can contribute to human disease.
26667302 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells by activating the transcription factor ELK1 via the JNK signaling pathway.
26617947 Downregulated expression of transcriptional activator ELK-1 may play an important role in the pathogenesis of atrial fibrillation.
26342199 results suggest that ELK1 plays an important role in bladder tumorigenesis and cancer progression.
26010542 These findings suggest that PKCalpha expression in HCC could be stimulated by the formation of MZF-1/Elk-1 complex, which directly binds to the PKCalpha promoter.
25537503 Data show that afatinib reduced Elk-1 transcription factor binding to the CIP2A protein promoter and suppressed CIP2A transcription.
25066273 interleukin-1beta (IL-1beta)-induced IER3 expression is mediated by the ERK1/2 target, transcription factor Elk-1.
24130510 our data suggest that preferential binding of activated Elk-1 to the IL10 rs3122605-G allele upregulates IL10 expression and confers increased risk for SLE in European Americans.
24121020 TNF-alpha modulation of intestinal epithelial tight junction barrier is regulated by ERK1/2 activation of Elk-1.
24072701 Two members of the ETS (E-26) family (PEA3 and ELK-1) regulate the expression of miRNA-200b. PEA3 promotes the expression of miRNA-200b, and ELK-1 is a transcriptional repressor of miRNA-200b.
23940030 FBXO25 mediates ELK-1 degradation through the ubiquitin proteasome system and thereby plays a role in regulating the activation of ELK-1 pathway in response to mitogens
23893408 novel GrB-EH(ITSN)-dependent pathogenic p38(MAPK)/Elk-1 signaling pathway involved in the poorly understood process of PL formation in severe PAH.
23871667 Analysis implies a role of ELK-1 in the differences between pluripotent stem cells with distinct X chromosome inactivation statuses.
23727019 Strikingly, promoters bound by ELK1 without ERK2 are occupied by Polycomb group proteins that repress genes involved in lineage commitment.
23463670 Sorafenib induces endometrial carcinoma apoptosis by inhibiting Elk-1-dependent Mcl-1 transcription and inducing Akt/GSK3beta-dependent protein degradation.
23454483 Ethanol increases Pol III transcription through a response element which is composed of the overlapping Elk1 and AP-1 binding sites of the TBP promoter. The binding sites may play a role in ethanol-induced deregulation of Pol III genes in liver tumors.
23426362 The ETS domain transcription factor ELK1 directs a critical component of growth signaling by the androgen receptor in prostate cancer cells.
23322625 Elk-1 interacts with the cell cycle kinase Aurora-A, and when Aurora inhibitors are used, P-S383-Elk-1 fails to localize to the poles and remains associated with DNA.
23284628 although ELK1 and GABPA ultimately control the same biological process, they do so by regulating different cohorts of target genes associated with cytoskeletal functions and cell migration contro
23127278 Elk1 is positively associated with estrogen receptor and Cyclin D1 expression in breast cancer. Luminal A/B Her-2 negative subtypes showed more Elk-1 activity compared to Her-2 and Basal subtype. No clinicopathologic or prognostic associations were found.
23117818 The binding of Ets1 and Elk1 together to the proximal CIP2A promoter is absolutely required for CIP2A expression in cervical, endometrial and liver carcinoma cell lines
23114923 Elk-1 pT417 is present in epithelial cell nuclei of various normal and cancer tissues and the number of pT417-positive cells correlates with differentiation grade of colonic adenocarcinomas.
22689058 Authors define the minimal promoter region of EVI1 and demonstrate that RUNX1 and ELK1, two proteins with essential functions in hematopoiesis, regulate EVI1 in AML.
22589737 This is demonstrated for the unique binding mode where a novel role for ELK1 in controlling cell migration is revealed.
22559731 Although the findings showed elevated expression of Elk-1 and PKCalpha in 5637 cells, the regulator of PKCalpha in bladder cancer cells is yet to be determined.
22433566 EGF activates TTP expression by activation of ELK-1 and EGR-1 transcription factors.
22354998 demonstrate that ELK-1 expression arises by a combination of leaky scanning and reinitiation, with the latter mediated by the small upstream ORF2 conserved in both spliced isoforms
22242952 association between the expression of PKCalpha and the expression of the transcription factors Elk-1 and MZF-1 in breast cancer cell lines
22085529 Activation of the Elk-1 led to an increased survival and a proliferative response with the EGF stimulation, and knocking-down the Elk-1 caused a decrease in survival of U138 glioblastoma cells.
22065579 Formation of ternary complex of human biliverdin reductase-protein kinase Cdelta-ERK2 protein is essential for ERK2-mediated activation of Elk1 protein, nuclear factor-kappaB, and inducible nitric-oxidase synthase (iNOS).
21796667 DJ-1 regulates SOD1 expression through Erk1/2-Elk1 pathway in its protective response to oxidative insult.
21655091 Genome-wide analysis reveals PADI4 cooperates with Elk-1 to activate c-Fos expression in breast cancer cells.
21642427 the ERK/ELK-1 cascade is involved in p53-independent induction of p21 and BAX gene expression.
21044953 small molecules such as celecoxib induce DR5 expression through activating ERK/RSK signaling and subsequent Elk1 activation and ATF4-dependent CHOP induction
20727996 Epidermal growth factor regulates PAI-1 expression via activation of the transcription factor Elk-1.
20680465 AC3-33 is a novel member of the secretory family and inhibits Elk1 transcriptional activity via ERK1/2 MAP
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20362031 findings suggest that MLL-AF4 family fusion oncoproteins can activate Elk-1 through Ras/MEK/extracellular signal-regulated kinase (ERK) pathway and strongly support the role of Ras signaling in the pathogenesis of MLL-rearranged leukemia
20337593 Results demonstrate that SENP1 is the most efficient SUMO protease acting on Elk-1, and that SENP3 has little effect on Elk-1. SENP2 has an intermediate effect, but its ability to activate Elk-1 is independent from its SUMO-deconjugating activity.
20224786 preferential activation of PTPRZ1 by HIF-2 results at least in part from cooperative binding of HIF-2 and ELK1 to nearby sites on the PTPRZ1 promoter region
20147408 The authors now show that the inactivation of either the Elk-1 or serum response factor (SRF) binding site within the enhancer also reduces major immediate-early promoter activation and viral replication of human cytomegalovirus in fibroblasts.
20126313 Data show that T417(+) Elk-1 uniquely associates with several types of inclusions present in Lewy body Disease, Alzheimer's disease, and Huntington's Disease.
20012528 Nef increases Elk1 phosphorylation via the activation of the ERK1/2 signaling pathway in primary CD4 T cells
19913121 Observational study of gene-disease association. (HuGE Navigator)
19687146 Data show that a significant overlaps between the ELK1- and SRF-binding regions, and between ELK1- and GABPA-binding regions.
19546342 polymorphism rs968567 influences FADS2 gene promoter activity and alters DNA binding affinity of the transcription factor ELK1.
19342628 FcgammaRIIIB, but not FcgammaRIIA, activates a unique signaling pathway leading to the nuclear-restricted phosphorylation of ERK and Elk-1, independently of Syk, PI3K, or MEK
19302787 Constitutive androstane receptor expression may be mediated by phosphorylated Elk-1 via the SAPK signaling pathway
19133234 Elk-1 is involved in upregulating HRI expression during stress along with a co-activator p300, while MZF-1 along with HDAC-1 is instrumental in its downregulation during hemin treatment.
19013529 Results suggest that Elk-1 is anchored to neuronal microtubules in resting or unstimulated cells, and upon stimulation is phosphorylated, which relocalizes phospho-Elk-1 to the nucleus in neurons.
18434015 the early growth response 1 gene is repressed by Elk1 in normally cycling SH-SY5Y neuroblastoma cell line
18316600 ERK and JNK MAPK/Elk-1/Egr-1 signal cascade is required for p53-independent transcriptional activation of p21(Waf1/Cip1) in response to curcumin in U-87MG human glioblastoma cells
18247360 These results strongly support that Elk-1 protein is a novel binding-protein partner for FAK, a finding that significantly broadens the potential functioning of FAK and Elk-1.
18172009 MDMX basal promoter activity requires c-Ets-1 and Elk-1. c-Ets-1 and Elk-1 control MDMX transcription and contribute to the suppression of p53 activity.
17967787 Hemin activated Elk-1, SRF, and NF-kappaB and promoted their interaction with the Egr-1 promoter
17898074 Elk-1 activated transcription of the HTLV-1 long terminal repeat (LTR), and mutations within either of the TCF sites or the CArG box reduced responsiveness of the LTR to Elk-1.
17804646 Elk-1 exerted opposite effects on hSlu7 transcription:Elk-1 protein represses transcription in a dose-dependent manner
17724016 BFGF activates the MAPK and NFkappB pathways that converge on ELK1 to control production of MMP13 by articular chondrocytes.
17591614 The 5' UTR controls ribosomal access to the ELK-1 AUG initiation codon.
17499043 Elk1 transcription factor targets a binding site in the TBP promoter and its occupancy of this region is reciprocal with that of Mif1.
17296730 Human Rev7 (hRev7)/MAD2B/MAD2L2 is an interaction partner for Elk-1 and hRev7 acts to promote Elk-1 phosphorylation by the c-Jun N-terminal protein kinase (JNK) MAP kinases.
17203534 Increased expression of transcription factor Elk-1 may play an important role in esophageal carcinogenesis.
17146445 PKC-eta-mediated glioblastoma proliferation involves MEK/mitogen-activated protein (MAP) kinase phosphorylation, activation of ERK and subsequently of Elk-1.
17074809 JNK1 and JNK2 differentially regulate TBP through Elk-1, controlling c-Jun expression and cell proliferation
16490785 PI3K through p21-activated kinase 1 regulates FRA-1 proto-oncogene induction by cigarette smoke and the subsequent activation of the Elk1 and cAMP-response element-binding protein transcription factors
16297876 PKCalpha expression may be modulated by Elk-1 and MZF-1 at the transcriptional level.
15808854 Data suggest that residues distal to the binding interface of DNA and Elk-1/SAP-1 may indirectly modulate the binding affinity by stabilizing the protein scaffold required for efficient DNA interaction.
15772901 Basal and inducible phosphorylation of Elk-1 is impaired in a patient with premature aging syndrome and insulin resistance.
15638726 Nef increases Elk1 phosphorylation via the activation of the ERK1/2 signaling pathway in primary CD4 T cells
15576363 H. pylori induction of villin in the stomach correlates with activation and cooperative binding of Elk-1 and the SRF to the proximal promoter of villin
15449318 Deletion analyses of the Egr-1 promoter identify a minimal estradiol-responsive region of the promoter containing a serum response element which binds Elk-1 and serum response factor.
15351693 transcriptional activities of ElK-1 and AP-1 are inhibited by TRIM45, a novel human RBCC/TRIM protein
15210726 SUMO conjugation is a novel regulator of Elk-1 function through the control of its nuclear-cytoplasmic shuttling.
12887893 ERK pathway activation leads to both phosphorylation of Elk-1 and loss of SUMO conjugation. This reciprocal regulation of activation and repression are coupled by MAP kinase modification of Elk-1.
12660819 role in signal cascade in immediate-early gene induction by anisomycin and arsenite
12409226 Bombesin-dependent activation of the transcription factor Elk-1 and significant increase of cell proliferation in prostate cancer cell lines
12242287 Interaction of serum response factor (SRF) with the Elk-1 B box inhibits RhoA-actin signaling to SRF and potentiates transcriptional activation by Elk-1
12077333 The Elk-1 R motif and the p300 CRD1 motif represent a new class of repression domains that are regulated in a context-dependent manner.
12023815 Complexities in Elk-1 transcription factor function and regulation
11726657 Nef increases Elk1 phosphorylation via the activation of the ERK1/2 signaling pathway in primary CD4 T cells

AA Sequence

MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDK      1 - 70
NIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIHAAPGDTVSGKPGTPKGAGMA     71 - 140
GPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVVLPSAAPAGAAAPPSGSRSTSPSPLEACLEA    141 - 210
EEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQE    211 - 280
GVPARLPAVVMDTAGQAGGHAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGP    281 - 350
ALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV    351 - 420
LSPGPQKP                                                                  421 - 428
//

Text Mined References (141)

PMID Year Title
26864615 2016 Silodosin inhibits prostate cancer cell growth via ELK1 inactivation and enhances the cytotoxic activity of gemcitabine.
26861876 2016 Reduced Ets Domain-containing Protein Elk1 Promotes Pulmonary Fibrosis via Increased Integrin ?v?6 Expression.
26667302 2016 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells.
26617947 2015 Downregulated protein expression of transcriptional activator ELK-1 in atrial myocardium of chronic AF patients.
26612202 2016 Functional characterization of a human POU1F1 mutation associated with isolated growth hormone deficiency: a novel etiology for IGHD.
26342199 2015 ELK1 is up-regulated by androgen in bladder cancer cells and promotes tumor progression.
26010542 2015 MZF-1/Elk-1 Complex Binds to Protein Kinase C? Promoter and Is Involved in Hepatocellular Carcinoma.
25537503 2015 Afatinib induces apoptosis in NSCLC without EGFR mutation through Elk-1-mediated suppression of CIP2A.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25066273 2014 Transcription factor Elk-1 participates in the interleukin-1?-dependent regulation of expression of immediate early response gene 3 (IER3).
24130510 2013 Preferential binding to Elk-1 by SLE-associated IL10 risk allele upregulates IL10 expression.
24121020 2013 TNF-? modulation of intestinal epithelial tight junction barrier is regulated by ERK1/2 activation of Elk-1.
24072701 2013 Regulation of the microRNA 200b (miRNA-200b) by transcriptional regulators PEA3 and ELK-1 protein affects expression of Pin1 protein to control anoikis.
23940030 2013 The F-box protein FBXO25 promotes the proteasome-dependent degradation of ELK-1 protein.
23893408 2013 A novel p38 mitogen-activated protein kinase/Elk-1 transcription factor-dependent molecular mechanism underlying abnormal endothelial cell proliferation in plexogenic pulmonary arterial hypertension.
23871667 2013 Human pluripotent stem cells with distinct X inactivation status show molecular and cellular differences controlled by the X-Linked ELK-1 gene.
23727019 2013 Genome-wide kinase-chromatin interactions reveal the regulatory network of ERK signaling in human embryonic stem cells.
23463670 2013 Sorafenib induces endometrial carcinoma apoptosis by inhibiting Elk-1-dependent Mcl-1 transcription and inducing Akt/GSK3?-dependent protein degradation.
23454483 2013 Elk1 and AP-1 sites in the TBP promoter mediate alcohol-induced deregulation of Pol III-dependent genes.
23426362 2013 The ETS domain transcription factor ELK1 directs a critical component of growth signaling by the androgen receptor in prostate cancer cells.
23395904 2013 Ubc9 acetylation modulates distinct SUMO target modification and hypoxia response.
23322625 2013 Phospho-Ser383-Elk-1 is localized to the mitotic spindles during cell cycle and interacts with mitotic kinase Aurora-A.
23284628 2012 The ETS transcription factors ELK1 and GABPA regulate different gene networks to control MCF10A breast epithelial cell migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23127278 2013 Immunohistochemical study of pElk-1 expression in human breast cancer: association with breast cancer biologic profile and clinicopathologic features.
23117818 Ets1 and Elk1 transcription factors regulate cancerous inhibitor of protein phosphatase 2A expression in cervical and endometrial carcinoma cells.
23114923 2013 Elk-1 phosphorylated at threonine-417 is present in diverse cancers and correlates with differentiation grade of colonic adenocarcinoma.
22689058 2013 Functional characterization of the promoter region of the human EVI1 gene in acute myeloid leukemia: RUNX1 and ELK1 directly regulate its transcription.
22589737 2012 ELK1 uses different DNA binding modes to regulate functionally distinct classes of target genes.
22559731 2012 Expression of protein kinase C? and the MZF-1 and elk-1 transcription factors in human bladder transitional cell carcinoma cells.
22433566 2012 EGF activates TTP expression by activation of ELK-1 and EGR-1 transcription factors.
22372926 2012 Activation of Elk-1 participates as a neuroprotective compensatory mechanism in models of Huntington's disease.
22354998 2012 Alternative splicing within the elk-1 5' untranslated region serves to modulate initiation events downstream of the highly conserved upstream open reading frame 2.
22343976 2012 Effects of resistance exercise intensity on extracellular signal-regulated kinase 1/2 mitogen-activated protein kinase activation in men.
22267484 2012 FGF19 signaling cascade suppresses APOA gene expression.
22242952 2012 Expression of protein kinase C ? and the MZF-1 and Elk-1 transcription factors in human breast cancer cells.
22222375 2012 RAS oncogenic signal upregulates EZH2 in pancreatic cancer.
22085529 2012 Both mitogen-activated protein kinase (MAPK)/extracellular-signal-regulated kinases (ERK) 1/2 and phosphatidylinositide-3-OH kinase (PI3K)/Akt pathways regulate activation of E-twenty-six (ETS)-like transcription factor 1 (Elk-1) in U138 glioblastoma cells.
22065586 2012 Oncogenic Ras and B-Raf proteins positively regulate death receptor 5 expression through co-activation of ERK and JNK signaling.
22065579 2012 Formation of ternary complex of human biliverdin reductase-protein kinase C?-ERK2 protein is essential for ERK2-mediated activation of Elk1 protein, nuclear factor-?B, and inducible nitric-oxidase synthase (iNOS).
21796667 2011 DJ-1 modulates the expression of Cu/Zn-superoxide dismutase-1 through the Erk1/2-Elk1 pathway in neuroprotection.
21655091 2011 Genome-wide analysis reveals PADI4 cooperates with Elk-1 to activate c-Fos expression in breast cancer cells.
21642427 2011 The ETS family transcription factor ELK-1 regulates induction of the cell cycle-regulatory gene p21(Waf1/Cip1) and the BAX gene in sodium arsenite-exposed human keratinocyte HaCaT cells.
21543455 2011 Dimer formation and conformational flexibility ensure cytoplasmic stability and nuclear accumulation of Elk-1.
21044953 2010 ERK/ribosomal S6 kinase (RSK) signaling positively regulates death receptor 5 expression through co-activation of CHOP and Elk1.
20727996 2010 Epidermal growth factor regulates PAI-1 expression via activation of the transcription factor Elk-1.
20680465 2011 AC3-33, a novel secretory protein, inhibits Elk1 transcriptional activity via ERK pathway.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20362031 2010 Activation of Ras-dependent Elk-1 activity by MLL-AF4 family fusion oncoproteins.
20337593 2010 SENP1 participates in the dynamic regulation of Elk-1 SUMOylation.
20224786 2010 Characterization of the activation of protein tyrosine phosphatase, receptor-type, Z polypeptide 1 (PTPRZ1) by hypoxia inducible factor-2 alpha.
20147408 2010 The Elk-1 and serum response factor binding sites in the major immediate-early promoter of human cytomegalovirus are required for efficient viral replication in quiescent cells and compensate for inactivation of the NF-kappaB sites in proliferating cells.
20126313 2010 A neurotoxic phosphoform of Elk-1 associates with inclusions from multiple neurodegenerative diseases.
20018936 2010 Phosphorylation and acetylation of histone H3 and autoregulation by early growth response 1 mediate interleukin 1beta induction of early growth response 1 transcription.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19687146 2009 Elucidation of the ELK1 target gene network reveals a role in the coordinate regulation of core components of the gene regulation machinery.
19546342 2010 A common FADS2 promoter polymorphism increases promoter activity and facilitates binding of transcription factor ELK1.
19342628 2009 FcgammaRIIA and FcgammaRIIIB mediate nuclear factor activation through separate signaling pathways in human neutrophils.
19302787 2009 Up-regulation of CAR expression through Elk-1 in HepG2 and SW480 cells by serum starvation stress.
19133234 2009 Stress-induced overexpression of the heme-regulated eIF-2alpha kinase is regulated by Elk-1 activated through ERK pathway.
19013529 2009 Elk-1 interacts with neuronal microtubules and relocalizes to the nucleus upon phosphorylation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18434015 2008 Wildtype Elk-1, but not a SUMOylation mutant, represses egr-1 expression in SH-SY5Y neuroblastomas.
18316600 2008 p21 Waf1/Cip1 expression by curcumin in U-87MG human glioma cells: role of early growth response-1 expression.
18247360 2008 Elk-1 associates with FAK, regulates the expression of FAK and MAP kinases as well as apoptosis in HK-2 cells.
18172009 2008 Regulation of MDMX expression by mitogenic signaling.
17967787 2008 Hemin upregulates Egr-1 expression in vascular smooth muscle cells via reactive oxygen species ERK-1/2-Elk-1 and NF-kappaB.
17898074 2007 Activation of the human T-cell leukemia virus type 1 long terminal repeat by the ternary complex factor Elk-1.
17804646 2007 Regulation of transcription of the RNA splicing factor hSlu7 by Elk-1 and Sp1 affects alternative splicing.
17724016 2007 Basic fibroblast growth factor activates the MAPK and NFkappaB pathways that converge on Elk-1 to control production of matrix metalloproteinase-13 by human adult articular chondrocytes.
17591614 2007 Alternatively spliced isoforms of the human elk-1 mRNA within the 5' UTR: implications for ELK-1 expression.
17499043 2007 Mammalian Maf1 is a negative regulator of transcription by all three nuclear RNA polymerases.
17296730 2007 Rev7/MAD2B links c-Jun N-terminal protein kinase pathway signaling to activation of the transcription factor Elk-1.
17203534 2006 Overexpression of Ets-like protein 1 in human esophageal squamous cell carcinoma.
17146445 2007 The protein kinase C-eta isoform induces proliferation in glioblastoma cell lines through an ERK/Elk-1 pathway.
17074809 2007 TBP is differentially regulated by c-Jun N-terminal kinase 1 (JNK1) and JNK2 through Elk-1, controlling c-Jun expression and cell proliferation.
17036045 2006 An extended consensus motif enhances the specificity of substrate modification by SUMO.
16533805 2006 Interacting JNK-docking sites in MKK7 promote binding and activation of JNK mitogen-activated protein kinases.
16490785 2006 A Phosphatidylinositol 3-kinase-regulated Akt-independent signaling promotes cigarette smoke-induced FRA-1 expression.
16297876 2006 PKCalpha expression regulated by Elk-1 and MZF-1 in human HCC cells.
16291755 2006 The tyrosine kinase Syk regulates TPL2 activation signals.
15920481 2005 PIASx acts as an Elk-1 coactivator by facilitating derepression.
15808854 2005 Modulating the DNA affinity of Elk-1 with computationally selected mutations.
15790681 2005 Foxp3 interacts with nuclear factor of activated T cells and NF-kappa B to repress cytokine gene expression and effector functions of T helper cells.
15782123 2005 p44/42 MAP kinase-dependent regulation of catalase by autocrine human growth hormone protects human mammary carcinoma cells from oxidative stress-induced apoptosis.
15772901 2005 Reduced phosphorylation of transcription factor Elk-1 in cultured fibroblasts of a patient with premature aging syndrome and insulin resistance.
15772651 2005 The DNA sequence of the human X chromosome.
15576363 2005 Helicobacter-induced intestinal metaplasia in the stomach correlates with Elk-1 and serum response factor induction of villin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449318 2004 Egr-1 is activated by 17beta-estradiol in MCF-7 cells by mitogen-activated protein kinase-dependent phosphorylation of ELK-1.
15351693 2004 TRIM45, a novel human RBCC/TRIM protein, inhibits transcriptional activities of ElK-1 and AP-1.
15210726 2004 SUMOylation regulates nucleo-cytoplasmic shuttling of Elk-1.
14992729 2004 SUMO promotes HDAC-mediated transcriptional repression.
14970218 2004 Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12947314 2003 beta1-integrin-ligand disengagement induces in vitro capillary tube disruption mediated by p38 MAPK activity.
12887893 2003 Dynamic interplay of the SUMO and ERK pathways in regulating Elk-1 transcriptional activity.
12750007 2003 Ets transcription factors ER81 and Elk1 regulate the transcription of the human presenilin 1 gene promoter.
12665513 2003 TAO (thousand-and-one amino acid) protein kinases mediate signaling from carbachol to p38 mitogen-activated protein kinase and ternary complex factors.
12660819 2003 Immediate-early gene induction by the stresses anisomycin and arsenite in human osteosarcoma cells involves MAPK cascade signaling to Elk-1, CREB and SRF.
12514134 2003 MAP kinase phosphorylation-dependent activation of Elk-1 leads to activation of the co-activator p300.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473660 2003 The stability of the G protein-coupled receptor-beta-arrestin interaction determines the mechanism and functional consequence of ERK activation.
12409226 2002 GRP receptor-mediated immediate early gene expression and transcription factor Elk-1 activation in prostate cancer cells.
12242287 2002 Interaction of serum response factor (SRF) with the Elk-1 B box inhibits RhoA-actin signaling to SRF and potentiates transcriptional activation by Elk-1.
12023815 2002 Complexities in ETS-domain transcription factor function and regulation: lessons from the TCF (ternary complex factor) subfamily. The Colworth Medal Lecture.
11313879 2001 c-Fos oncogene regulator Elk-1 interacts with BRCA1 splice variants BRCA1a/1b and enhances BRCA1a/1b-mediated growth suppression in breast cancer cells.
11279280 2001 alpha-Synuclein forms a complex with transcription factor Elk-1.
11050086 2001 Opposing roles of Elk-1 and its brain-specific isoform, short Elk-1, in nerve growth factor-induced PC12 differentiation.
10997882 2000 Binding of stromal derived factor-1alpha (SDF-1alpha) to CXCR4 chemokine receptor in normal human megakaryoblasts but not in platelets induces phosphorylation of mitogen-activated protein kinase p42/44 (MAPK), ELK-1 transcription factor and serine/threonine kinase AKT.
10947953 2000 A novel transcriptional factor with Ser/Thr kinase activity involved in the transforming growth factor (TGF)-beta signalling pathway.
10742173 2000 Structure of the elk-1-DNA complex reveals how DNA-distal residues affect ETS domain recognition of DNA.
10716983 2000 Ribosomal subunit kinase-2 is required for growth factor-stimulated transcription of the c-Fos gene.
10637505 1999 ERK activation induces phosphorylation of Elk-1 at multiple S/T-P motifs to high stoichiometry.
10231026 1999 Structural organization of the human Elk1 gene and its processed pseudogene Elk2.
10022839 1999 Id helix-loop-helix proteins inhibit nucleoprotein complex formation by the TCF ETS-domain transcription factors.
9795224 1998 The human elk-1 gene family: the functional gene and two processed pseudogenes embedded in the IgH locus.
9696047 1998 Induction of apoptosis by Elk-1 and deltaElk-1 proteins.
9644975 1998 Ets transcription factors: nuclear effectors of the Ras-MAP-kinase signaling pathway.
9570133 1997 The ETS-domain transcription factor family.
9430721 1998 Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6.
9235954 1997 p38-2, a novel mitogen-activated protein kinase with distinct properties.
9130707 1997 Convergence of MAP kinase pathways on the ternary complex factor Sap-1a.
9010223 1997 FLI1 and EWS-FLI1 function as ternary complex factors and ELK1 and SAP1a function as ternary and quaternary complex factors on the Egr1 promoter serum response elements.
8941362 1996 MAP kinase-dependent transcriptional coactivation by Elk-1 and its cofactor CBP.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8855261 1996 Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.
8798570 1996 Ligand activation of ELK receptor tyrosine kinase promotes its association with Grb10 and Grb2 in vascular endothelial cells.
8622669 1996 MKK3- and MKK6-regulated gene expression is mediated by the p38 mitogen-activated protein kinase signal transduction pathway.
8586671 1995 Neither ERK nor JNK/SAPK MAP kinase subtypes are essential for histone H3/HMG-14 phosphorylation or c-fos and c-jun induction.
8575773 1995 Locations of the ets subfamily members net, elk1, and sap1 (ELK3, ELK1, and ELK4) on three homologous regions of the mouse and human genomes.
8548291 1995 Activation of ternary complex factor Elk-1 by stress-activated protein kinases.
8417810 1993 Delta elk-1, a variant of elk-1, fails to interact with the serum response factor and binds to DNA with modulated specificity.
8386592 1993 The SRF accessory protein Elk-1 contains a growth factor-regulated transcriptional activation domain.
8208531 1994 elk-1 proteins interact with MAP kinases.
7927346 1994 Refined mapping of the human Ets-related gene Elk-1 to Xp11.2-p11.4, distal to the OATL1 region.
7889942 1995 ERK phosphorylation potentiates Elk-1-mediated ternary complex formation and transactivation.
7540136 1995 Comparative analysis of the ternary complex factors Elk-1, SAP-1a and SAP-2 (ERP/NET).
2539641 1989 elk, tissue-specific ets-related genes on chromosomes X and 14 near translocation breakpoints.
1630903 1992 Elk-1 protein domains required for direct and SRF-assisted DNA-binding.