Property Summary

NCBI Gene PubMed Count 11
PubMed Score 102.60
PubTator Score 25.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 2.3e-07
Breast cancer -1.200 4.7e-26
group 3 medulloblastoma 1.100 5.8e-04
osteosarcoma -1.601 2.8e-05
pituitary cancer 1.300 2.3e-05
posterior fossa group A ependymoma 1.200 1.3e-09
psoriasis -2.400 3.7e-05

Gene RIF (1)

AA Sequence

MSMDVTFLGTGAAYPSPTRGASAVVLRCEGECWLFDCGEGTQTQLMKSQLKAGRITKIFITHLHGDHFFG      1 - 70
LPGLLCTISLQSGSMVSKQPIEIYGPVGLRDFIWRTMELSHTELVFHYVVHELVPTADQCPAEELKEFAH     71 - 140
VNRADSPPKEEQGRTILLDSEENSYLLFDDEQFVVKAFRLFHRIPSFGFSVVEKKRPGKLNAQKLKDLGV    141 - 210
PPGPAYGKLKNGISVVLENGVTISPQDVLKKPIVGRKICILGDCSGVVGDGGVKLCFEADLLIHEATLDD    211 - 280
AQMDKAKEHGHSTPQMAATFAKLCRAKRLVLTHFSQRYKPVALAREGETDGIAELKKQAESVLDLQEVTL    281 - 350
AEDFMVISIPIKK                                                             351 - 363
//

Text Mined References (11)

PMID Year Title