Property Summary

NCBI Gene PubMed Count 25
PubMed Score 16.96
PubTator Score 19.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Rheumatoid Arthritis 1.800 3.2e-03
hepatocellular carcinoma -1.900 7.1e-05
astrocytic glioma 1.300 1.1e-02
ependymoma 1.200 2.9e-02
oligodendroglioma 1.100 2.4e-02
psoriasis -3.100 4.3e-06
osteosarcoma -2.683 9.7e-07
X-linked recessive Emery-Dreifuss muscul... 1.086 9.7e-03
Amyotrophic Lateral Sclerosis 1.035 7.9e-06
tuberculosis -1.100 2.8e-02
primary pancreatic ductal adenocarcinoma 1.093 7.9e-03
intraductal papillary-mucinous adenoma (... 1.700 4.1e-04
intraductal papillary-mucinous carcinoma... 1.400 8.6e-04
intraductal papillary-mucinous neoplasm ... 2.000 2.9e-04
lung cancer 1.600 6.1e-03
lung adenocarcinoma 1.176 7.3e-06
lung carcinoma 1.200 1.5e-31
gastric carcinoma 1.100 2.2e-02
ovarian cancer 2.100 1.1e-05

Protein-protein Interaction (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPVPQGPQYCIPQ      1 - 70
YRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKK     71 - 140
TIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPV    141 - 210
TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIA    211 - 280
APTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLV    281 - 350
SSTNLINEINGVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT    351 - 420
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQTEEILDSQNL    421 - 490
NSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKVLESEQDKMSQGFHPERDPSD    491 - 560
LKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSSGDGVTFPFKPESWKPTDTEGKKQYDREFLL    561 - 630
DFQFMPACIQKPEGLPPISDVVLDKINQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVG    631 - 700
SRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMF    701 - 770
NQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR    771 - 840
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIM    841 - 910
HDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLR    911 - 980
LCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPS    981 - 1050
KFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEF   1051 - 1120
DSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNS   1121 - 1190
TEAERNKTRESAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR   1191 - 1260
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKE   1261 - 1330
GGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQ   1331 - 1400
KLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAV   1401 - 1470
CKAAIIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEV   1471 - 1540
ISEDAFYKWESSKDPAEQNGKGVALKSVTAFFTWLREAEEESEDN                            1541 - 1585
//

Text Mined References (36)

PMID Year Title
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18426977 2008 eIF4GI links nutrient sensing by mTOR to cell proliferation and inhibition of autophagy.
18088087 2008 Phosphoproteome of resting human platelets.
17693683 2007 Quantitative phosphoproteome profiling of Wnt3a-mediated signaling network: indicating the involvement of ribonucleoside-diphosphate reductase M2 subunit phosphorylation at residue serine 20 in canonical Wnt signal transduction.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15361857 2004 eIF4G is required for the pioneer round of translation in mammalian cells.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15016848 2004 Cleavage of eukaryotic translation initiation factor 4GII within foot-and-mouth disease virus-infected cells: identification of the L-protease cleavage site in vitro.
14507913 2003 Phosphorylation screening identifies translational initiation factor 4GII as an intracellular target of Ca(2+)/calmodulin-dependent protein kinase I.
12975586 2003 Backbone resonance assignment of human eukaryotic translation initiation factor 4E (eIF4E) in complex with 7-methylguanosine diphosphate (m7GDP) and a 17-amino acid peptide derived from human eIF4GII.
12663812 2003 Human rhinovirus 2A proteinase cleavage sites in eukaryotic initiation factors (eIF) 4GI and eIF4GII are different.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11172724 2001 A conserved HEAT domain within eIF4G directs assembly of the translation initiation machinery.
10872469 1999 eIF4 initiation factors: effectors of mRNA recruitment to ribosomes and regulators of translation.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10022874 1999 Phosphorylation of the cap-binding protein eukaryotic translation initiation factor 4E by protein kinase Mnk1 in vivo.
9878069 1999 Human eukaryotic translation initiation factor 4G (eIF4G) recruits mnk1 to phosphorylate eIF4E.
9857202 1998 A newly identified N-terminal amino acid sequence of human eIF4G binds poly(A)-binding protein and functions in poly(A)-dependent translation.
9418880 1998 A novel functional human eukaryotic translation initiation factor 4G.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.