Property Summary

NCBI Gene PubMed Count 25
PubMed Score 17.76
PubTator Score 19.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Amyotrophic lateral sclerosis 1.035 7.9e-06
astrocytic glioma 1.300 1.1e-02
ependymoma 1.200 2.9e-02
gastric carcinoma 1.100 2.2e-02
hepatocellular carcinoma -1.900 7.1e-05
intraductal papillary-mucinous adenoma (... 1.700 4.1e-04
intraductal papillary-mucinous carcinoma... 1.400 8.6e-04
intraductal papillary-mucinous neoplasm ... 2.000 2.9e-04
lung adenocarcinoma 1.176 7.3e-06
lung cancer 1.600 6.1e-03
lung carcinoma 1.200 1.5e-31
oligodendroglioma 1.100 2.4e-02
osteosarcoma -2.683 9.7e-07
ovarian cancer -1.300 5.4e-06
primary pancreatic ductal adenocarcinoma 1.093 7.9e-03
psoriasis -3.100 4.3e-06
Rheumatoid arthritis 1.400 5.4e-03
tuberculosis -1.100 2.8e-02
X-linked recessive Emery-Dreifuss muscul... 1.086 9.7e-03

Protein-protein Interaction (5)

Gene RIF (1)

AA Sequence

MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPVPQGPQYCIPQ      1 - 70
YRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKK     71 - 140
TIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPV    141 - 210
TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIA    211 - 280
APTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLV    281 - 350
SSTNLINEINGVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT    351 - 420
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQTEEILDSQNL    421 - 490
NSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKVLESEQDKMSQGFHPERDPSD    491 - 560
LKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSSGDGVTFPFKPESWKPTDTEGKKQYDREFLL    561 - 630
DFQFMPACIQKPEGLPPISDVVLDKINQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVG    631 - 700
SRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMF    701 - 770
NQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR    771 - 840
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIM    841 - 910
HDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLR    911 - 980
LCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPS    981 - 1050
KFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEF   1051 - 1120
DSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNS   1121 - 1190
TEAERNKTRESAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR   1191 - 1260
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKE   1261 - 1330
GGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQ   1331 - 1400
KLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAV   1401 - 1470
CKAAIIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEV   1471 - 1540
ISEDAFYKWESSKDPAEQNGKGVALKSVTAFFTWLREAEEESEDN                            1541 - 1585
//

Text Mined References (36)

PMID Year Title