Property Summary

NCBI Gene PubMed Count 25
PubMed Score 7.84
PubTator Score 13.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Protein-protein Interaction (10)

Gene RIF (11)

PMID Text
26370510 Tristetraprolin recruits eukaryotic initiation factor 4E2 (eIF4E2) to repress target mRNA translation.
25624349 DNA damage induces an increase in ARIH1 protein levels and association of ARIH1 with 4EHP. In turn, this causes 4EHP recruitment to the mRNA cap, where it is known to compete with eIF4E.
24408918 Activation of eIF4E2-directed translation is essential for cancer cells.
23991149 provide evidence that eIF4E2 binds 4E-T in the yeast two hybrid assay, as well as in pull-down assays and by recruitment to P-bodies in mammalian cells
22751931 GIGYF2 and the zinc finger protein 598 (ZNF598) are identified as components of the 4EHP complex.
21079520 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17369309 4EHP binds cap analogs m(7)GpppG and m(7)GTP with low affinity
17368478 4EHP plays a physiological role utilizing both cap-binding and protein-binding functions but which is distinct from eIF4E.
17289916 ISGylation of 4EHP may play an important role in cap structure-dependent translation control in immune responses.
15094042 4EHP over-expression instigates a negative feedback loop that inhibits upstream signaling to 4E-BP1 and ribosomal protein S6 kinase 1 (S6K1) whereas the 4E-BP1-binding-deficient mutant of 4EHP(W95A) was unable to trigger this feedback loop

AA Sequence

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPG      1 - 70
RPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR     71 - 140
KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT    141 - 210
IMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP                                       211 - 245
//

Text Mined References (30)

PMID Year Title
26370510 2015 Tristetraprolin Recruits Eukaryotic Initiation Factor 4E2 To Repress Translation of AU-Rich Element-Containing mRNAs.
25624349 2015 The E3 ubiquitin ligase ARIH1 protects against genotoxic stress by initiating a 4EHP-mediated mRNA translation arrest.
25416956 2014 A proteome-scale map of the human interactome network.
24408918 2014 Cancer cells exploit eIF4E2-directed synthesis of hypoxia response proteins to drive tumor progression.
23991149 2013 Investigating the consequences of eIF4E2 (4EHP) interaction with 4E-transporter on its cellular distribution in HeLa cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22751931 2012 A novel 4EHP-GIGYF2 translational repressor complex is essential for mammalian development.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
21079520 2011 Genome-wide association study on overall survival of advanced non-small cell lung cancer patients treated with carboplatin and paclitaxel.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19060904 2009 An empirical framework for binary interactome mapping.
17369309 2007 Weak binding affinity of human 4EHP for mRNA cap analogs.
17368478 2007 Structures of the human eIF4E homologous protein, h4EHP, in its m7GTP-bound and unliganded forms.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17289916 2007 ISG15 modification of the eIF4E cognate 4EHP enhances cap structure-binding activity of 4EHP.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15153109 2004 Characterization of mammalian eIF4E-family members.
15094042 2004 Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623119 2003 Human homologue of ariadne promotes the ubiquitylation of translation initiation factor 4E homologous protein, 4EHP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
9582349 1998 Cloning and characterization of 4EHP, a novel mammalian eIF4E-related cap-binding protein.