Property Summary

NCBI Gene PubMed Count 39
PubMed Score 94.62
PubTator Score 83.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 3.9e-06
medulloblastoma, large-cell 6234 3.3e-04
psoriasis 6685 5.6e-04
osteosarcoma 7933 6.4e-04
lung cancer 4473 1.4e-03
oligodendroglioma 2849 4.2e-02

Expression

  Differential Expression (6)

Disease log2 FC p
oligodendroglioma 1.100 4.2e-02
psoriasis -2.100 5.6e-04
osteosarcoma -1.014 6.4e-04
medulloblastoma, large-cell 1.100 3.3e-04
lung cancer 1.200 1.4e-03
ovarian cancer -2.000 3.9e-06

Gene RIF (19)

PMID Text
25955794 MicroRNA-216a inhibits the growth and metastasis of oral squamous cell carcinoma by targeting eIF4B.
25631074 Cellular biotinylated eukaryotic translation initiation factor 4B (EIF4B) protein is incorporated into HIV-1 Gag virus-like particles
25220053 S6K1 enhances c-Myc translation efficiency by modulating the phosphorylation of eukaryotic initiation factor eIF4B, which is critical to unwind its structured 5' untranslated region.
25129346 EIF4B, as a potentially key fragile point in EGFR and mTOR inhibitor synergy.
24829357 The protein level of eukaryotic translation initiation factor 4B (eIF4B) was dramatically reduced in A549 cells as well as in the lung, spleen, and thymus of mice infected with influenza A virus.
24205356 eIF4B is the RSK downstream effector responsible for elevated Lamgamma2 as well as MYC protein in neoplastic epithelial cells.
24135829 eIF4B-driven expression of these key survival proteins is directly correlated with patient outcome, and eIF4B, DAXX and ERCC5 are identified as novel prognostic markers for poor survival in DLBCL
24063684 Report EIF4B binding within the IRES domain V of the coxsackie virus B3 mutant strain.
23813671 Overexpression of pim-2 may inhibit the apoptosis of prostate cancer cells through phosphorylation of eIF4B, thus promoting tumorigenesis.
23749639 our results identify eIF4B as a critical substrate of Pim kinases in mediating the activity of Abl oncogenes
21994950 ORF45/RSK axis-induced eIF4B phosphorylation is involved in translational regulation and is required for optimal KSHV lytic replication.
21840318 Duplex unwinding and ATPase activities of the DEAD-box helicase eIF4A are coupled by eIF4G and eIF4B.
21427765 Studies indicate that eIF4A (DDX2), together with its accessory proteins eIF4B and eIF4H, is thought to act as a helicase that unwinds secondary structures in the mRNA 5' UTR.
19369421 Data show that reduced levels of eIF4B, eIF4H, or polyA-binding protein, also trigger SG formation.
18719248 The interaction of eIF4AI with two accessory factors, eIF4B and eIF4H, was studied.
16763566 Phosphorylation of eIF4B on Ser422 by p90 ribosomal protein S6 kinase (RSK) and S6K is physiologically significant, as it increases the interaction of eIF4B with the eukaryotic translation initiation factor 3.
15078951 data indicate that eIF4B and 4H stimulate the nuclease activity of herpes simplex virus vhs, and they provide evidence that additional mammalian factors are required for targeting to the encephalomyocarditis virus IRES
15071500 eIF4B may mediate some of the effects of the ribosomal protein S6 kinases on translation
12885229 The solution structure of the eIF4B RNA recognition motif (RRM) domain is reported; the core RRM domain provides only a relative weak interaction with RNA targets and appears to require extensions at the N- and C-terminus for high-affinity binding.

AA Sequence

MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDR      1 - 70
SILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFG     71 - 140
YAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDD    141 - 210
YPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRA    211 - 280
FGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS    281 - 350
TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT    351 - 420
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSN    421 - 490
PPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESD    491 - 560
RKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDGEDENEGEDYAE                       561 - 611
//

Text Mined References (53)

PMID Year Title
25955794 2015 MicroRNA-216a inhibits the growth and metastasis of oral squamous cell carcinoma by targeting eukaryotic translation initiation factor 4B.
25220053 2014 The mTORC1/S6K1 pathway regulates glutamine metabolism through the eIF4B-dependent control of c-Myc translation.
25129346 2014 Abrogating phosphorylation of eIF4B is required for EGFR and mTOR inhibitor synergy in triple-negative breast cancer.
24829357 2014 Influenza A virus-induced degradation of eukaryotic translation initiation factor 4B contributes to viral replication by suppressing IFITM3 protein expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24205356 2013 RSK activation of translation factor eIF4B drives abnormal increases of laminin ?2 and MYC protein during neoplastic progression to squamous cell carcinoma.
24135829 2014 A role for eukaryotic initiation factor 4B overexpression in the pathogenesis of diffuse large B-cell lymphoma.
24063684 2013 Impaired binding of standard initiation factors eIF3b, eIF4G and eIF4B to domain V of the live-attenuated coxsackievirus B3 Sabin3-like IRES--alternatives for 5'UTR-related cardiovirulence mechanisms.
23813671 2013 The over-expression of Pim-2 promote the tumorigenesis of prostatic carcinoma through phosphorylating eIF4B.
23749639 2013 eIF4B phosphorylation by pim kinases plays a critical role in cellular transformation by Abl oncogenes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21994950 2011 Phosphorylation of eukaryotic translation initiation factor 4B (EIF4B) by open reading frame 45/p90 ribosomal S6 kinase (ORF45/RSK) signaling axis facilitates protein translation during Kaposi sarcoma-associated herpesvirus (KSHV) lytic replication.
21887822 2011 Proteomic identification of Hsp70 as a new Plk1 substrate in arsenic trioxide-induced mitotically arrested cells.
21840318 2011 Duplex unwinding and ATPase activities of the DEAD-box helicase eIF4A are coupled by eIF4G and eIF4B.
21743057 2011 Genome-wide association study identifies new prostate cancer susceptibility loci.
21427765 2011 mRNA helicases: the tacticians of translational control.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369421 2009 Uncoupling stress granule assembly and translation initiation inhibition.
18719248 2008 Interactions between eIF4AI and its accessory factors eIF4B and eIF4H.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17924679 2007 Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16763566 2006 The mTOR/PI3K and MAPK pathways converge on eIF4B to control its phosphorylation and activity.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15314020 2004 Upstream and downstream of mTOR.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15078951 2004 Herpes simplex virus virion host shutoff protein is stimulated by translation initiation factors eIF4B and eIF4H.
15071500 2004 Phosphorylation of eucaryotic translation initiation factor 4B Ser422 is modulated by S6 kinases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12885229 2003 Solution structure and RNA interactions of the RNA recognition motif from eukaryotic translation initiation factor 4B.
12588972 2003 Transcript-selective translational silencing by gamma interferon is directed by a novel structural element in the ceruloplasmin mRNA 3' untranslated region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11274152 2001 Disruption of the interaction of mammalian protein synthesis eukaryotic initiation factor 4B with the poly(A)-binding protein by caspase- and viral protease-mediated cleavages.
10672017 2000 Changes in integrity and association of eukaryotic protein synthesis initiation factors during apoptosis.
10585411 1999 Further biochemical and kinetic characterization of human eukaryotic initiation factor 4H.
8816444 1996 A region rich in aspartic acid, arginine, tyrosine, and glycine (DRYG) mediates eukaryotic initiation factor 4B (eIF4B) self-association and interaction with eIF3.
8182051 1994 Two structural domains of initiation factor eIF-4B are involved in binding to RNA.
8139536 1994 The translation initiation factor eIF-4B contains an RNA-binding region that is distinct and independent from its ribonucleoprotein consensus sequence.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
6722878 1984 Translational initiation factor and ribosome association with the cytoskeletal framework fraction from HeLa cells.
2390971 1990 Cloning and expression of eukaryotic initiation factor 4B cDNA: sequence determination identifies a common RNA recognition motif.