Property Summary

NCBI Gene PubMed Count 42
PubMed Score 98.52
PubTator Score 83.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 3.9e-06
medulloblastoma, large-cell 6241 3.3e-04
psoriasis 6694 5.6e-04
osteosarcoma 7950 6.4e-04
lung cancer 4740 1.4e-03
oligodendroglioma 2850 4.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Cancer 2499 3.01 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.200 1.4e-03
medulloblastoma, large-cell 1.100 3.3e-04
oligodendroglioma 1.100 4.2e-02
osteosarcoma -1.014 6.4e-04
ovarian cancer -2.000 3.9e-06
psoriasis -2.100 5.6e-04

Protein-protein Interaction (4)

Gene RIF (22)

AA Sequence

MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDDDVYRAPPIDR      1 - 70
SILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLNISAVRLPREPSNPERLKGFG     71 - 140
YAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWRARPATDSFDD    141 - 210
YPPRRGDDSFGDKYRDRYDSDRYRDGYRDGYRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRA    211 - 280
FGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSAS    281 - 350
TSQSTRAASIFGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT    351 - 420
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPKENAWVKRSSN    421 - 490
PPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESD    491 - 560
RKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDGEDENEGEDYAE                       561 - 611
//

Text Mined References (57)

PMID Year Title