Property Summary

NCBI Gene PubMed Count 4,127
PubMed Score 9318.14
PubTator Score 20799.95

Knowledge Summary

Patent (1,239,008)

TINX Plot

  Disease Sources (8)

Disease Target Count P-value
breast carcinoma 1614 3.1072863611735E-38
medulloblastoma, large-cell 6234 3.29070986574721E-5
pilocytic astrocytoma 3086 4.53013876572464E-5
invasive ductal carcinoma 2950 6.19811898786687E-5
atypical teratoid / rhabdoid tumor 4369 1.36359431354211E-4
Pick disease 1893 2.13176703616612E-4
pituitary cancer 1972 3.9382057606738E-4
interstitial cystitis 2299 5.14022477712826E-4
Rheumatoid Arthritis 1171 6.70770907628913E-4
adult high grade glioma 2148 0.00109718149664308
oligodendroglioma 2849 0.00169942053496658
acute quadriplegic myopathy 1157 0.00260579519174214
cutaneous lupus erythematosus 1056 0.00478267216662234
astrocytic glioma 2241 0.00494781641954118
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00822520368341969
medulloblastoma 1524 0.0104972690827315
sarcoidosis 368 0.0135242184931784
spina bifida 1064 0.0165213520016134
subependymal giant cell astrocytoma 2287 0.0267674352621099
Disease Target Count Z-score Confidence
Brain cancer 24 0.0 2.0
Malignant glioma 23 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 8.112 4.0

Expression

  Differential Expression (26)

Disease log2 FC p
lung cancer -5.000 0.000
glioblastoma 3.400 0.000
osteosarcoma 2.175 0.000
Rheumatoid Arthritis 1.700 0.001
astrocytic glioma 3.100 0.005
oligodendroglioma 3.100 0.002
cutaneous lupus erythematosus -1.800 0.005
medulloblastoma 2.400 0.010
atypical teratoid / rhabdoid tumor 3.600 0.000
medulloblastoma, large-cell 4.700 0.000
acute quadriplegic myopathy 1.302 0.003
breast carcinoma -2.300 0.000
pancreatic ductal adenocarcinoma liver m... -1.253 0.008
non-small cell lung cancer 1.387 0.000
interstitial cystitis -1.200 0.001
adult high grade glioma 3.300 0.001
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma 1.612 0.027
invasive ductal carcinoma -2.218 0.000
spina bifida -1.926 0.017
Pick disease 2.000 0.000
Breast cancer -3.100 0.000
ductal carcinoma in situ -1.600 0.042
ovarian cancer 2.700 0.000
pituitary cancer -2.000 0.000
sarcoidosis 1.300 0.014

Synonym

Accession P00533 O00688 O00732 P06268 Q14225 Q68GS5 Q92795 Q9BZS2 Q9GZX1 Q9H2C9 Q9H3C9 Q9UMD7 Q9UMD8 Q9UMG5
Symbols ERBB
HER1
mENA
ERBB1
PIG61
NISBD2

Gene

PDB

2RF9   2RFD   2RFE   4I21   4R3P   4R3R   4ZJV   2KS1   1MOX   1IVO   1NQL   3NJP   3OP0   3VRP   3VRR   1DNQ   1DNR   1M14   1M17   1XKK   1YY9   1Z9I   2EB2   2EB3   2EXP   2EXQ   2GS2   2GS6   2GS7   2ITN   2ITO   2ITP   2ITQ   2ITT   2ITU   2ITV   2ITW   2ITX   2ITY   2ITZ   2J5E   2J5F   2J6M   2JIT   2JIU   2JIV   2M0B   2M20   2N5S   2RGP   3B2U   3B2V   3BEL   3BUO   3C09   3G5V   3G5Y   3GOP   3GT8   3IKA   3LZB   3OB2   3P0Y   3PFV   3POZ   3QWQ   3UG1   3UG2   3VJN   3VJO   3W2O   3W2P   3W2Q   3W2R   3W2S   3W32   3W33   4G5J   4G5P   4HJO   4I1Z   4I20   4I22   4I23   4I24   4JQ7   4JQ8   4JR3   4JRV   4KRL   4KRM   4KRO   4KRP   4LI5   4LL0   4LQM   4LRM   4R5S   4RIW   4RIX   4RIY   4RJ4   4RJ5   4RJ6   4RJ7   4RJ8   4TKS   4UIP   4UV7   4WD5   4WKQ   4WRG   4ZAU   4ZSE   5C8K   5C8M   5C8N   5CAL   5CAN   5CAO   5CAP   5CAQ   5CAS   5CAU   5CAV   5CNN   5CNO   5CZH   5CZI   5D41   5EDP   5EDQ   5EDR   5EM5   5EM6   5EM7   5EM8   5FED   5FEE   5FEQ   5HCX   5HCZ   5HG5   5HG7   5HG8   5HG9   5HIB   5HIC   5J9Z   5JEB  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (2)

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
1726 confirmatory 3 / 4 / 18 Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: EGFR T790M/L858R Kinase Inhibition
1727 confirmatory 8 / 1 / 16 Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: EGFR L858R Kinase Inhibition
1729 confirmatory 4 / 8 / 13 Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: EGFR T790M Kinase Inhibition
1731 confirmatory 8 / 1 / 19 Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: EGFR Kinase Inhibition
1742 summary 10 / 0 / 0 Quantitative High-Throughput Screen for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: Summary
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (3976)

PMID Text
27306810 Consecutive patients with advanced/recurrent non-small cell lung cancer (NSCLC)harboring activating EGFR mutations were treated with platinum combined with Pemetrexed
27273943 Overexpression of MMP2 and EGFR were independent risk factors for mortality in non-small cell lung cancer patients.
27203102 Authors' experiments argue against ARNO being a robust modifier of EGFR catalytic activity.
27180345 Studied prevalence of EGFR activating mutations in squamous cell carcinomas and adenosquamous carcinomas of the lung in patients of the Southern Bulgarian region.
27070783 Expression and Prognostic Significance of Human Epidermal Growth Factor Receptors 1, 2 and 3 in Periampullary Adenocarcinoma
27069157 The pemetrexed-carboplatin combination was effective and well-tolerated in patients with EGFR-wild-type non-squamous NSCLC.
27069134 HER Family Protein Expression in a Greek Population with Gastric Cancer. A Retrospective Hellenic Cooperative Oncology Group Study
27067779 our data suggest roles for HRAS and EGFR as drivers in a subset of poroma and porocarcinoma.
27055285 EGFR expression and activation was not found to be an independent prognostic factor in breast cancer survival outcome.
27050434 results suggested that C/EBPalpha-saRNA successfully inhibited HCC metastasis by inhibiting EGFR/beta-catenin signaling pathway mediated EMT in vitro and in vivo
More...

AA Sequence

MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYV      1 - 70
QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDANKTGLKELPMRNL     71 - 140
QEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCDPSCPNGSCWGAGEENCQKL    141 - 210
TKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVN    211 - 280
PEGKYSFGATCVKKCPRNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLS    281 - 350
INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF    351 - 420
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKI    421 - 490
ISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHP    491 - 560
ECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTG    561 - 630
PGLEGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPN    631 - 700
QALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVD    701 - 770
NPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA    771 - 840
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTF    841 - 910
GSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLV    911 - 980
IQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSRTPLLSSLSATSNNSTVACI    981 - 1050
DRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPS   1051 - 1120
RDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGS   1121 - 1190
TAENAEYLRVAPQSSEFIGA                                                     1191 - 1210
//

Text Mined References (4157)

PMID Year Title
27306810 2016 [Association between Efficacy of Pemetrexed and EGFR Mutation Status for EGFR Mutated Lung Carcinoma].
27273943 Prognostic significance of overexpressed matrix metalloproteinase-2, mouse-double minute: 2 homolog and epidermal growth factor receptor in non-small cell lung cancer.
27203102 2016 Lack of Evidence that CYTH2/ARNO Functions as a Direct Intracellular EGFR Activator.
27180345 Epidermal Growth Factor Receptor Activating Mutations in Squamous Histology of Lung Cancer Patients of Southern Bulgaria.
27070783 2016 Expression and Prognostic Significance of Human Epidermal Growth Factor Receptors 1, 2 and 3 in Periampullary Adenocarcinoma.
27069157 2016 Phase II Study of Carboplatin and Pemetrexed in Advanced EGFR-wild-type Non-squamous Non-small Cell Lung Cancer: The Central Japan Lung Study Group Trial 0906.
27069134 2016 HER Family Protein Expression in a Greek Population with Gastric Cancer. A Retrospective Hellenic Cooperative Oncology Group Study.
27067779 2016 Porocarcinomas harbor recurrent HRAS-activating mutations and tumor suppressor inactivating mutations.
27059931 2016 Weak binding to E3 ubiquitin ligase c-Cbl increases EGFRvA protein stability.
27057632 2016 Tumor-suppressive miR-218-5p inhibits cancer cell proliferation and migration via EGFR in non-small cell lung cancer.
More...