Property Summary

NCBI Gene PubMed Count 15
PubMed Score 38.40
PubTator Score 9.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Latent syphilis 3 3.469 1.7

Gene RIF (5)

PMID Text
21965749 The down-regulation of EGFL8 might be a novel biomarker for advanced gastric cancer.
21737648 Reduced expression of EGFL8 is closely related to metastastic potential and poor prognosis of CRC, suggesting the down-regulation of EGFL8 as a novel prognostic biomarker for CRC patients.
20587610 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19143814 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYNESYSQPVYKPYLTLCAGRRI      1 - 70
CSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLNGGVCVRPDQCECAPGWGGKH     71 - 140
CHVDVDECRTSITLCSHHCFNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERA    141 - 210
LKQEIHELRGRLERLEQWAGQAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS    211 - 280
CEDNSLGLGVNHR                                                             281 - 293
//

Text Mined References (15)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
21965749 2011 Down-regulation of EGFL8: a novel biomarker for advanced gastric cancer.
21737648 2011 Down-regulation of EGFL8: a novel prognostic biomarker for patients with colorectal cancer.
21323541 2011 Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19143814 2009 Several loci in the HLA class III region are associated with T1D risk after adjusting for DRB1-DQB1.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.