Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1281.43
PubTator Score 496.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma 1.900 2.4e-03
astrocytoma 2.000 9.7e-03
Astrocytoma, Pilocytic 2.100 1.5e-04
atypical teratoid / rhabdoid tumor 1.100 2.6e-03
colon cancer -2.900 1.4e-02
cutaneous lupus erythematosus -1.200 3.7e-02
cystic fibrosis -1.165 6.9e-05
ependymoma 1.600 3.2e-06
esophageal adenocarcinoma -2.400 1.8e-02
glioblastoma 2.000 5.6e-07
group 3 medulloblastoma 1.800 2.4e-02
interstitial cystitis -1.200 1.4e-03
intraductal papillary-mucinous adenoma (... -1.200 8.6e-04
intraductal papillary-mucinous carcinoma... -1.100 2.0e-03
lung cancer -2.200 8.6e-04
medulloblastoma, large-cell 2.000 1.2e-03
non-small cell lung cancer 1.291 8.3e-08
oligodendroglioma 2.300 8.1e-03
ovarian cancer 2.000 1.2e-04
pituitary cancer 1.400 1.4e-02
primitive neuroectodermal tumor 2.300 1.8e-05
psoriasis -1.100 5.6e-04

Gene RIF (4)

AA Sequence

MAIATSTQLARALYDNTAESPQELSFRRGDVLRVLQREGAGGLDGWCLCSLHGQQGIVPANRVKLLPAGP      1 - 70
APKPSLSPASPAQPGSPYPAPDHSNEDQEVYVVPPPARPCPTSGPPAGPCPPSPDLIYKIPRASGTQLAA     71 - 140
PRDALEVYDVPPTALRVPSSGPYDCPASFSHPLTRVAPQPPGEDDAPYDVPLTPKPPAELEPDLEWEGGR    141 - 210
EPGPPIYAAPSNLKRASALLNLYEAPEELLADGEGGGTDEGIYDVPLLGPEAPPSPEPPGALASHDQDTL    211 - 280
AQLLARSPPPPHRPRLPSAESLSRRPLPALPVPEAPSPSPVPSPAPGRKGSIQDRPLPPPPPRLPGYGGP    281 - 350
KVEGDPEGREMEDDPAGHHNEYEGIPMAEEYDYVHLKGMDKAQGSRPPDQACTGDPELPERGMPAPQEAL    351 - 420
SPGEPLVVSTGDLQLLYFYAGQCQSHYSALQAAVAALMSSTQANQPPRLFVPHSKRVVVAAHRLVFVGDT    421 - 490
LGRLAASAPLRAQVRAAGTALGQALRATVLAVKGAALGYPSSPAIQEMVQCVTELAGQALQFTTLLTSLA    491 - 560
P//

Text Mined References (16)

PMID Year Title