Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.78
PubTator Score 0.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.262 4.8e-02
psoriasis 1.100 6.2e-04
oligodendroglioma -1.100 2.7e-11
osteosarcoma 2.021 5.1e-05
ependymoma -1.400 6.1e-13
glioblastoma -2.000 1.8e-05
medulloblastoma -2.400 6.5e-07
atypical teratoid / rhabdoid tumor -2.400 3.0e-10
medulloblastoma, large-cell -2.300 1.1e-03
primitive neuroectodermal tumor -2.300 2.0e-07
hereditary spastic paraplegia -1.039 3.9e-02
lung cancer -1.600 4.3e-04
adult high grade glioma -1.700 2.9e-03
pilocytic astrocytoma -1.300 2.0e-05
severe Alzheimer's disease -1.154 3.0e-02
ovarian cancer 1.400 2.6e-02
dermatomyositis 1.200 3.1e-04

Gene RIF (2)

PMID Text
25380825 These data suggest that mammalian Efr3s contribute to the control of the phosphorylation state and, hence, desensitization of AT1a receptors, and could affect responsiveness of G-protein-coupled receptors in higher eukaryotes.
22082156 Knockdown of EFR3 homolog A (S. cerevisiae) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N

AA Sequence

MPTRVCCCCSALRPRYKRLVDNIFPEDPKDGLVKTDMEKLTFYAVSAPEKLDRIGSYLAERLSRDVVRHR      1 - 70
SGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRY     71 - 140
DFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE    141 - 210
VDSRIGPPSSPSATDKEENPAVLAENCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKII    211 - 280
MYSIQAQYSHHVIQEILGHLDARKKDAPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVE    281 - 350
FEANDLQGGSVGSVNLNTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLD    351 - 420
ISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRH    421 - 490
DNRAKLRGIRIIPDVADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITI    491 - 560
ELANEEVVIDLIRLAIALQDSAIINEDNLPMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIEIRTM    561 - 630
EAPYFLPEHIFRDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRLSRRKSIV    631 - 700
DTVSIQVDILSNNVPSDDVVSNTEEITFEALKKAIDTSGMEEQEKEKRRLVIEKFQKAPFEEIAAQCESK    701 - 770
ANLLHDRLAQILELTIRPPPSPSGTLTITSGHAQYQSVPVYEMKFPDLCVY                       771 - 821
//

Text Mined References (18)

PMID Year Title
26571211 2016 The leukodystrophy protein FAM126A (hyccin) regulates PtdIns(4)P synthesis at the plasma membrane.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
25380825 2015 EFR3s are palmitoylated plasma membrane proteins that control responsiveness to G-protein-coupled receptors.
24860643 2014 Rare deleterious mutations of the gene EFR3A in autism spectrum disorders.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23374588 2013 Pharmacogenomics in Alzheimer's disease: a genome-wide association study of response to cholinesterase inhibitors.
23229899 2012 PtdIns4P synthesis by PI4KIII? at the plasma membrane and its impact on plasma membrane identity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363888 2004 Mouse homolog of KIAA0143 protein: hearing deficit induces specific changes of expression in auditory brainstem neurons.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.