Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.11
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 1.6e-07
osteosarcoma 7950 2.2e-06
ependymoma 4679 1.4e-05
medulloblastoma, large-cell 6241 9.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 2.100 1.4e-05
medulloblastoma, large-cell -1.100 9.1e-04
nasopharyngeal carcinoma -3.500 1.6e-07
osteosarcoma -1.888 2.2e-06

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MNMEIGHPHEGKDDLGDKRVIMGTKFPMELGIRVGLGKEDSRCGESPVVSNKCEGRMAPPETKFPLSKGL      1 - 70
EMGLERQNISRTVMQRGSLGVDSVSASQGTKPSLLPGRMGLENESLLAGYTHERIIQPPLGRVCGSSQAA     71 - 140
GSRRAPLASGPEGVEELVGKPAFVMEPRQEMEKESTCVLMKPNTEIKLPVEVDIGLTQAEGPDETKNTEP    141 - 210
QMGLVIEPPQCQFAQQHEQRKEAGNIESGVEPPDRIRPIYSGKFFDRTPCWPSAGKVIPVGYRVATCLTE    211 - 280
KLPRLITPPEAKKYFNFRYPPAGVERVFYGRANDPQIAPYLTHGIRSKISVLANTLINPQPITTFQQKIK    281 - 350
DKKESIYLSNRRAPLGKSHDQAPGLPKGMDTTNTTFGTAVIKEYSAKDVVNPPKSYEEVFKEGNEGHDLY    351 - 420
VVSHNDYYAGEAKNRKYNPSSFHRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFVSKRADDFKEK    421 - 490
FQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRGKDRQRALIAAVRHHLKKVNY    491 - 560
QKFDTLLAAFRHYDKKGDGMIDKDELQEACDQANLSLDDKLLDQLFDYCDVDNDGFINYLEFANFLNWKD    561 - 630
KMLLKEYEERVIIKGRKPDCVNPTEANVEEPEQTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKT    631 - 700
TSSEINAIVGAIPSTCYPICGVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFARKGVFERDFFK    701 - 770
TRSKEEIAEILCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVLDELRHADRIKCKTLM           771 - 833
//

Text Mined References (5)

PMID Year Title