Property Summary

Ligand Count 209
NCBI Gene PubMed Count 209
PubMed Score 1756.68
PubTator Score 600.15

Knowledge Summary

Patent (27,777)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Waardenburg's syndrome 17 5.896 2.9

Expression

  Differential Expression (30)

Disease log2 FC p
tuberculosis -1.900 1.2e-04
adrenocortical adenoma -1.257 1.4e-02
adrenocortical carcinoma -1.808 1.2e-02
astrocytoma 1.700 3.5e-13
breast carcinoma -1.500 2.6e-05
colon cancer -1.400 2.6e-02
cystic fibrosis and chronic rhinosinusit... 1.817 3.5e-02
Down syndrome 1.100 2.7e-03
ductal carcinoma in situ -1.400 4.8e-05
ependymoma 1.100 8.4e-04
gastric carcinoma 1.300 4.9e-02
group 3 medulloblastoma -1.700 4.2e-03
inflammatory breast cancer -1.600 1.2e-03
intraductal papillary-mucinous adenoma (... -1.800 5.8e-04
intraductal papillary-mucinous carcinoma... -2.900 7.9e-04
intraductal papillary-mucinous neoplasm ... -3.600 3.4e-04
invasive ductal carcinoma -2.487 2.1e-04
lung adenocarcinoma -2.800 2.0e-15
lung cancer -2.600 4.7e-04
lung carcinoma -1.200 8.7e-05
medulloblastoma, large-cell -2.500 3.9e-05
Multiple myeloma 3.537 1.5e-02
nephrosclerosis 1.808 9.1e-03
non-small cell lung cancer -3.063 3.3e-33
oligodendroglioma 1.800 2.3e-02
ovarian cancer -1.700 1.1e-05
pancreatic ductal adenocarcinoma liver m... -1.193 2.9e-03
Pick disease -1.200 4.5e-03
ulcerative colitis 1.700 2.3e-04
urothelial carcinoma 1.600 1.2e-02

Gene RIF (178)

AA Sequence

MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAE      1 - 70
VPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILI     71 - 140
ASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSRIK    141 - 210
GIGVPKWTAVEIVLIWVVSVVLAVPEAIGFDIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSF    211 - 280
YFCLPLAITAFFYTLMTCEMLRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLY    281 - 350
NQNDPNRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC    351 - 420
LKFKANDHGYDNFRSSNKYSSS                                                    421 - 442
//

Text Mined References (212)

PMID Year Title