Property Summary

NCBI Gene PubMed Count 19
PubMed Score 65.07
PubTator Score 28.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 1.0e-06
osteosarcoma 7933 4.4e-05
psoriasis 6685 1.0e-04
dermatomyositis 966 3.2e-04
diabetes mellitus 1663 1.6e-03
Multiple myeloma 1327 1.6e-03
Polycystic Ovary Syndrome 334 6.7e-03

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.227 1.6e-03
psoriasis 1.600 1.0e-04
osteosarcoma -1.889 4.4e-05
diabetes mellitus -1.400 1.6e-03
Polycystic Ovary Syndrome 1.076 6.7e-03
ovarian cancer 2.500 1.0e-06
dermatomyositis 1.300 3.2e-04

Gene RIF (4)

PMID Text
21782027 According to this study multiprotein bridging factor 1 and Calmodulin do not interact in vitro as confirmed by NMR spectroscopy and CaM-agarose affinity chromatography.
16567061 The EDF-1 minimal promoter was characterized.
12040021 Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism.
9813014 HIV-1 Tat, which affects endothelial functions, downregulates EDF-1 expression both at the RNA and protein levels

AA Sequence

MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHH      1 - 70
DRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKP     71 - 140
IEKGPRAK                                                                  141 - 148
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24008843 2013 Structure homology and interaction redundancy for discovering virus-host protein interactions.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21782027 2011 Human multiprotein bridging factor 1 and Calmodulin do not interact in vitro as confirmed by NMR spectroscopy and CaM-agarose affinity chromatography.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16567061 2006 Characterization of the human EDF-1 minimal promoter: involvement of NFY and Sp1 in the regulation of basal transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15112053 2004 The dual role of endothelial differentiation-related factor-1 in the cytosol and nucleus: modulation by protein kinase A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12040021 2002 Multiprotein bridging factor-1 (MBF-1) is a cofactor for nuclear receptors that regulate lipid metabolism.
10816571 2000 Interaction between endothelial differentiation-related factor-1 and calmodulin in vitro and in vivo.
10567391 1999 The role of human MBF1 as a transcriptional coactivator.
10469174 1999 Identification of the core domain and the secondary structure of the transcriptional coactivator MBF1.
9813014 1998 EDF-1, a novel gene product down-regulated in human endothelial cell differentiation.
8164657 1994 Mediators of activation of fushi tarazu gene transcription by BmFTZ-F1.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.