Property Summary

NCBI Gene PubMed Count 14
PubMed Score 2.45
PubTator Score 2.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis 1.800 1.2e-02
hepatocellular carcinoma 1.200 1.4e-05
pancreatic cancer 1.200 1.6e-03
psoriasis 1.200 2.0e-04
osteosarcoma 3.490 8.2e-08
tuberculosis and treatment for 6 months -1.200 5.0e-05
intraductal papillary-mucinous adenoma (... 2.500 3.9e-03
intraductal papillary-mucinous carcinoma... 2.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 2.400 2.1e-02
diabetes mellitus -1.300 3.4e-03
Breast cancer 3.400 2.4e-02
pancreatic carcinoma 1.200 1.6e-03
lung adenocarcinoma 1.268 7.0e-05
ovarian cancer 2.900 2.6e-06

 GWAS Trait (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 gp120 is identified to have a physical interaction with ER degradation enhancer, mannosidase alpha-like 3 (EDEM3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MSEAGGRGCGSPVPQRARWRLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMFDHAYGNYMEH      1 - 70
AYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKTKEFEDAVRKVLRDVNLDNDV     71 - 140
VVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELLQMAKQLGYKLLPAFNTTSGLPYPRINLKFG    141 - 210
IRKPEARTGTETDTCTACAGTLILEFAALSRFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGD    211 - 280
WVRKDSGVGAGIDSYYEYLLKAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDA    281 - 350
LLAFFPGLQVLKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP    351 - 420
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDIIFDIEDYIFT    421 - 490
TEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPLYAQSIREPLKNVVDKSCPRG    491 - 560
IIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLIHLKDGRVQLVQHAIQAASSIDAEDGLRFMQ    561 - 630
EMIELSSQQQKEQQLPPRAVQIVSHPFFGRVVLTAGPAQFGLDLSKHKETRGFVASSKPSNGCSELTNPE    631 - 700
AVMGKIALIQRGQCMFAEKARNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSK    701 - 770
EGSIILDAIREYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSL    771 - 840
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPI    841 - 910
DSILADWNEDIEAFEMMEKDEL                                                    911 - 932
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25092655 2014 EDEM2 initiates mammalian glycoprotein ERAD by catalyzing the first mannose trimming step.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18303019 2008 Getting in and out from calnexin/calreticulin cycles.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17499246 2007 Glycoprotein folding and the role of EDEM1, EDEM2 and EDEM3 in degradation of folding-defective glycoproteins.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16431915 2006 EDEM3, a soluble EDEM homolog, enhances glycoprotein endoplasmic reticulum-associated degradation and mannose trimming.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15579471 2005 A novel stress-induced EDEM variant regulating endoplasmic reticulum-associated glycoprotein degradation.
15537790 2005 Human EDEM2, a novel homolog of family 47 glycosidases, is involved in ER-associated degradation of glycoproteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11318611 2001 Cloning and characterization of 13 novel transcripts and the human RGS8 gene from the 1q25 region encompassing the hereditary prostate cancer (HPC1) locus.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.