Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.79
PubTator Score 6.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.200 1.2e-03
astrocytic glioma -1.400 4.0e-02
intraductal papillary-mucinous neoplasm ... 1.600 3.6e-02
osteosarcoma -2.023 7.0e-07
ovarian cancer -1.100 6.7e-04
spina bifida -1.011 3.4e-02

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTP      1 - 70
PMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPP     71 - 140
PPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSS    141 - 210
SGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNTLRNDLQLSESGSDSDD                211 - 268
//

Text Mined References (24)

PMID Year Title