Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession E9PB15
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MFSLPLNCSPDHIRRGSCWGRPQDLKIAAPAWNSKCHPGAGAAMARQHARTLWYDRPRYVFMEFCVEDST      1 - 70
DVHVLIEDHRIVFSCKNADGVELYNEIEFYAKVNSKPVWLSVDFDNWRDWEGDEEMELAHVEHYAELLKK     71 - 140
VSTKRPPPAMDDLDDDSDSADDATSN                                                141 - 166
//

Text Mined References (4)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11181995 2001 The sequence of the human genome.