Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 0.009
ependymoma -2.400 0.008
oligodendroglioma -2.400 0.003
osteosarcoma -3.478 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.600 0.005
sonic hedgehog group medulloblastoma -1.400 0.005
medulloblastoma, large-cell -1.700 0.000
ovarian cancer -2.000 0.000
pituitary cancer 1.200 0.001

Synonym

Accession E7EU14 B3KSW5
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MAEMRAWRPLVRPSLQCVKLGRATARWWWVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVV      1 - 70
DSLDIESMTIEGEYSGPKLEDDKVTITFMKGLMQWYKDQKKLHQKCAYQGLALSPRLKCSGTITAHCSLN     71 - 140
LLGPRDPPTSASQVAVTEGMHHHTWLIFLFL                                           141 - 171
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.