Property Summary

NCBI Gene PubMed Count 9
PubMed Score 65.93
PubTator Score 16.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.900 9.4e-06
astrocytoma -1.100 1.9e-17
Astrocytoma, Pilocytic -2.400 6.7e-11
atypical teratoid / rhabdoid tumor -1.700 1.2e-05
ependymoma -2.500 1.9e-14
glioblastoma -1.800 6.9e-10
inflammatory breast cancer -1.200 4.4e-04
lung cancer -1.600 2.4e-04
non-small cell lung cancer -1.169 2.1e-13
osteosarcoma 2.390 4.8e-06
psoriasis -2.700 5.5e-05
subependymal giant cell astrocytoma -1.844 3.9e-02

Synonym

Accession Q13202 Q86SS8
Symbols HB5
HVH8
HVH-5
C11orf81

Gene

PDB

4JMK  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (3)

AA Sequence

MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQQGKVTIAELI      1 - 70
QPAARSQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVAILTGGFATFSSCFPGLCEGK     71 - 140
PAALLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKDLMTQNGISYVLNASNSCPKPDFICESRFMR    141 - 210
VPINDNYCEKLLPWLDKSIEFIDKAKLSSCQVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRR    211 - 280
PSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAREG    281 - 350
GLSAGGEPPAPPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDGPGPPDPGEAP    351 - 420
KLCKLDSPSGAALGLSSPSPDSPDAAPEARPRPRRRPRPPAGSPARSPAHSLGLNFGDAARQTPRHGLSA    421 - 490
LSAPGLPGPGQPAGPGAWAPPLDSPGTPSPDGPWCFSPEGAQGAGGVLFAPFGRAGAPGPGGGSDLRRRE    491 - 560
AARAEPRDARTGWPEEPAPETQFKRRSCQMEFEEGMVEGRARGEELAALGKQASFSGSVEVIEVS         561 - 625
//

Text Mined References (12)

PMID Year Title